package sdk
import "github.com/aws/aws-sdk-go-v2"
Package sdk is the official AWS SDK v2 for the Go programming language.
aws-sdk-go-v2 is the Developer Preview for the v2 of the AWS SDK for the Go programming language. Look for additional documentation and examples to be added.
Getting started
The best way to get started working with the SDK is to use `go get` to add the SDK to your Go Workspace manually.
go get github.com/aws/aws-sdk-go-v2
You could also use [Dep] to add the SDK to your application's dependencies. Using [Dep] will simplify your update story and help your application keep pinned to specific version of the SDK
dep ensure --add github.com/aws/aws-sdk-go-v2
### Hello AWS
This example shows how you can use the v2 SDK to make an API request using the SDK's Amazon DynamoDB client.
package main
import (
"github.com/aws/aws-sdk-go-v2/aws"
"github.com/aws/aws-sdk-go-v2/aws/endpoints"
"github.com/aws/aws-sdk-go-v2/aws/external"
"github.com/aws/aws-sdk-go-v2/service/dynamodb"
)
func main() {
// Using the SDK's default configuration, loading additional config
// and credentials values from the environment variables, shared
// credentials, and shared configuration files
cfg, err := external.LoadDefaultAWSConfig()
if err != nil {
panic("unable to load SDK config, " + err.Error())
}
// Set the AWS Region that the service clients should use
cfg.Region = endpoints.UsWest2RegionID
// Using the Config value, create the DynamoDB client
svc := dynamodb.New(cfg)
// Build the request with its input parameters
req := svc.DescribeTableRequest(&dynamodb.DescribeTableInput{
TableName: aws.String("myTable"),
})
// Send the request, and get the response or error back
resp, err := req.Send()
if err != nil {
panic("failed to describe table, "+err.Error())
}
fmt.Println("Response", resp)
}
Index ¶
Source Files ¶
Directories ¶
| Path | Synopsis |
|---|---|
| aws | Package aws provides the core SDK's utilities and shared types. |
| aws/arn | Package arn provides a parser for interacting with Amazon Resource Names. |
| aws/awserr | Package awserr represents API error interface accessors for the SDK. |
| aws/defaults | Package defaults is a collection of helpers to retrieve the SDK's default configuration and handlers. |
| aws/ec2metadata | Package ec2metadata provides the client for making API calls to the EC2 Metadata service. |
| aws/ec2rolecreds | |
| aws/endpointcreds | Package endpointcreds provides support for retrieving credentials from an arbitrary HTTP endpoint. |
| aws/endpoints | Package endpoints provides the types and functionality for defining regions and endpoints, as well as querying those definitions. |
| aws/external | |
| aws/plugincreds | Package plugincreds implements a credentials provider sourced from a Go plugin. |
| aws/signer | |
| aws/signer/v2 | |
| aws/signer/v4 | Package v4 implements signing for AWS V4 signer |
| aws/stscreds | Package stscreds are credential Providers to retrieve STS AWS credentials. |
| internal | |
| models | |
| models/endpoints | Package endpoints contains the models for endpoints that should be used to generate endpoint definition files for the SDK. |
| private | |
| private/protocol | |
| private/protocol/ec2query | Package ec2query provides serialization of AWS EC2 requests and responses. |
| private/protocol/json | |
| private/protocol/json/jsonutil | Package jsonutil provides JSON serialization of AWS requests and responses. |
| private/protocol/jsonrpc | Package jsonrpc provides JSON RPC utilities for serialization of AWS requests and responses. |
| private/protocol/query | Package query provides serialization of AWS query requests, and responses. |
| private/protocol/query/queryutil | |
| private/protocol/rest | Package rest provides RESTful serialization of AWS requests and responses. |
| private/protocol/restjson | Package restjson provides RESTful JSON serialization of AWS requests and responses. |
| private/protocol/restxml | Package restxml provides RESTful XML serialization of AWS requests and responses. |
| private/protocol/xml | |
| private/protocol/xml/xmlutil | Package xmlutil provides XML serialization of AWS requests and responses. |
| private/util | |
| service | Package service contains automatically generated AWS clients. |
| service/acm | Package acm provides the client and types for making API requests to AWS Certificate Manager. |
| service/acm/acmiface | Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code. |
| service/acmpca | Package acmpca provides the client and types for making API requests to AWS Certificate Manager Private Certificate Authority. |
| service/acmpca/acmpcaiface | Package acmpcaiface provides an interface to enable mocking the AWS Certificate Manager Private Certificate Authority service client for testing your code. |
| service/alexaforbusiness | Package alexaforbusiness provides the client and types for making API requests to Alexa For Business. |
| service/alexaforbusiness/alexaforbusinessiface | Package alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code. |
| service/apigateway | Package apigateway provides the client and types for making API requests to Amazon API Gateway. |
| service/apigateway/apigatewayiface | Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code. |
| service/applicationautoscaling | Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling. |
| service/applicationautoscaling/applicationautoscalingiface | Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code. |
| service/applicationdiscoveryservice | Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service. |
| service/applicationdiscoveryservice/applicationdiscoveryserviceiface | Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code. |
| service/appstream | Package appstream provides the client and types for making API requests to Amazon AppStream. |
| service/appstream/appstreamiface | Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code. |
| service/appsync | Package appsync provides the client and types for making API requests to AWS AppSync. |
| service/appsync/appsynciface | Package appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code. |
| service/athena | Package athena provides the client and types for making API requests to Amazon Athena. |
| service/athena/athenaiface | Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code. |
| service/autoscaling | Package autoscaling provides the client and types for making API requests to Auto Scaling. |
| service/autoscaling/autoscalingiface | Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code. |
| service/autoscalingplans | Package autoscalingplans provides the client and types for making API requests to AWS Auto Scaling Plans. |
| service/autoscalingplans/autoscalingplansiface | Package autoscalingplansiface provides an interface to enable mocking the AWS Auto Scaling Plans service client for testing your code. |
| service/batch | Package batch provides the client and types for making API requests to AWS Batch. |
| service/batch/batchiface | Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code. |
| service/budgets | Package budgets provides the client and types for making API requests to AWS Budgets. |
| service/budgets/budgetsiface | Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code. |
| service/cloud9 | Package cloud9 provides the client and types for making API requests to AWS Cloud9. |
| service/cloud9/cloud9iface | Package cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code. |
| service/clouddirectory | Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory. |
| service/clouddirectory/clouddirectoryiface | Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code. |
| service/cloudformation | Package cloudformation provides the client and types for making API requests to AWS CloudFormation. |
| service/cloudformation/cloudformationiface | Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code. |
| service/cloudfront | Package cloudfront provides the client and types for making API requests to Amazon CloudFront. |
| service/cloudfront/cloudfrontiface | Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code. |
| service/cloudfront/sign | Package sign provides utilities to generate signed URLs for Amazon CloudFront. |
| service/cloudhsm | Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM. |
| service/cloudhsm/cloudhsmiface | Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code. |
| service/cloudhsmv2 | Package cloudhsmv2 provides the client and types for making API requests to AWS CloudHSM V2. |
| service/cloudhsmv2/cloudhsmv2iface | Package cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code. |
| service/cloudsearch | Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch. |
| service/cloudsearch/cloudsearchiface | Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code. |
| service/cloudsearchdomain | Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain. |
| service/cloudsearchdomain/cloudsearchdomainiface | Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code. |
| service/cloudtrail | Package cloudtrail provides the client and types for making API requests to AWS CloudTrail. |
| service/cloudtrail/cloudtrailiface | Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code. |
| service/cloudwatch | Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch. |
| service/cloudwatch/cloudwatchiface | Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code. |
| service/cloudwatchevents | Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events. |
| service/cloudwatchevents/cloudwatcheventsiface | Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code. |
| service/cloudwatchlogs | Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs. |
| service/cloudwatchlogs/cloudwatchlogsiface | Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code. |
| service/codebuild | Package codebuild provides the client and types for making API requests to AWS CodeBuild. |
| service/codebuild/codebuildiface | Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code. |
| service/codecommit | Package codecommit provides the client and types for making API requests to AWS CodeCommit. |
| service/codecommit/codecommitiface | Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code. |
| service/codedeploy | Package codedeploy provides the client and types for making API requests to AWS CodeDeploy. |
| service/codedeploy/codedeployiface | Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code. |
| service/codepipeline | Package codepipeline provides the client and types for making API requests to AWS CodePipeline. |
| service/codepipeline/codepipelineiface | Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code. |
| service/codestar | Package codestar provides the client and types for making API requests to AWS CodeStar. |
| service/codestar/codestariface | Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code. |
| service/cognitoidentity | Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity. |
| service/cognitoidentity/cognitoidentityiface | Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code. |
| service/cognitoidentityprovider | Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider. |
| service/cognitoidentityprovider/cognitoidentityprovideriface | Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code. |
| service/cognitosync | Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync. |
| service/cognitosync/cognitosynciface | Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code. |
| service/comprehend | Package comprehend provides the client and types for making API requests to Amazon Comprehend. |
| service/comprehend/comprehendiface | Package comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code. |
| service/configservice | Package configservice provides the client and types for making API requests to AWS Config. |
| service/configservice/configserviceiface | Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code. |
| service/connect | Package connect provides the client and types for making API requests to Amazon Connect Service. |
| service/connect/connectiface | Package connectiface provides an interface to enable mocking the Amazon Connect Service service client for testing your code. |
| service/costandusagereportservice | Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service. |
| service/costandusagereportservice/costandusagereportserviceiface | Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code. |
| service/costexplorer | Package costexplorer provides the client and types for making API requests to AWS Cost Explorer Service. |
| service/costexplorer/costexploreriface | Package costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code. |
| service/databasemigrationservice | Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service. |
| service/databasemigrationservice/databasemigrationserviceiface | Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code. |
| service/datapipeline | Package datapipeline provides the client and types for making API requests to AWS Data Pipeline. |
| service/datapipeline/datapipelineiface | Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code. |
| service/dax | Package dax provides the client and types for making API requests to Amazon DynamoDB Accelerator (DAX). |
| service/dax/daxiface | Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code. |
| service/devicefarm | Package devicefarm provides the client and types for making API requests to AWS Device Farm. |
| service/devicefarm/devicefarmiface | Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code. |
| service/directconnect | Package directconnect provides the client and types for making API requests to AWS Direct Connect. |
| service/directconnect/directconnectiface | Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code. |
| service/directoryservice | Package directoryservice provides the client and types for making API requests to AWS Directory Service. |
| service/directoryservice/directoryserviceiface | Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code. |
| service/dynamodb | Package dynamodb provides the client and types for making API requests to Amazon DynamoDB. |
| service/dynamodb/dynamodbattribute | Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues. |
| service/dynamodb/dynamodbiface | Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code. |
| service/dynamodb/expression | Package expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps. |
| service/dynamodbstreams | Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams. |
| service/dynamodbstreams/dynamodbstreamsiface | Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code. |
| service/ec2 | Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud. |
| service/ec2/ec2iface | Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code. |
| service/ecr | Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry. |
| service/ecr/ecriface | Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code. |
| service/ecs | Package ecs provides the client and types for making API requests to Amazon EC2 Container Service. |
| service/ecs/ecsiface | Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code. |
| service/efs | Package efs provides the client and types for making API requests to Amazon Elastic File System. |
| service/efs/efsiface | Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code. |
| service/elasticache | Package elasticache provides the client and types for making API requests to Amazon ElastiCache. |
| service/elasticache/elasticacheiface | Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code. |
| service/elasticbeanstalk | Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk. |
| service/elasticbeanstalk/elasticbeanstalkiface | Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code. |
| service/elasticsearchservice | Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service. |
| service/elasticsearchservice/elasticsearchserviceiface | Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code. |
| service/elastictranscoder | Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder. |
| service/elastictranscoder/elastictranscoderiface | Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code. |
| service/elb | Package elb provides the client and types for making API requests to Elastic Load Balancing. |
| service/elb/elbiface | Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. |
| service/elbv2 | Package elbv2 provides the client and types for making API requests to Elastic Load Balancing. |
| service/elbv2/elbv2iface | Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. |
| service/emr | Package emr provides the client and types for making API requests to Amazon Elastic MapReduce. |
| service/emr/emriface | Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code. |
| service/firehose | Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose. |
| service/firehose/firehoseiface | Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code. |
| service/fms | Package fms provides the client and types for making API requests to Firewall Management Service. |
| service/fms/fmsiface | Package fmsiface provides an interface to enable mocking the Firewall Management Service service client for testing your code. |
| service/gamelift | Package gamelift provides the client and types for making API requests to Amazon GameLift. |
| service/gamelift/gameliftiface | Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code. |
| service/glacier | Package glacier provides the client and types for making API requests to Amazon Glacier. |
| service/glacier/glacieriface | Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code. |
| service/glue | Package glue provides the client and types for making API requests to AWS Glue. |
| service/glue/glueiface | Package glueiface provides an interface to enable mocking the AWS Glue service client for testing your code. |
| service/greengrass | Package greengrass provides the client and types for making API requests to AWS Greengrass. |
| service/greengrass/greengrassiface | Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code. |
| service/guardduty | Package guardduty provides the client and types for making API requests to Amazon GuardDuty. |
| service/guardduty/guarddutyiface | Package guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code. |
| service/health | Package health provides the client and types for making API requests to AWS Health APIs and Notifications. |
| service/health/healthiface | Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code. |
| service/iam | Package iam provides the client and types for making API requests to AWS Identity and Access Management. |
| service/iam/iamiface | Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code. |
| service/inspector | Package inspector provides the client and types for making API requests to Amazon Inspector. |
| service/inspector/inspectoriface | Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code. |
| service/iot | Package iot provides the client and types for making API requests to AWS IoT. |
| service/iot1clickdevicesservice | Package iot1clickdevicesservice provides the client and types for making API requests to AWS IoT 1-Click Devices Service. |
| service/iot1clickdevicesservice/iot1clickdevicesserviceiface | Package iot1clickdevicesserviceiface provides an interface to enable mocking the AWS IoT 1-Click Devices Service service client for testing your code. |
| service/iot1clickprojects | Package iot1clickprojects provides the client and types for making API requests to AWS IoT 1-Click Projects Service. |
| service/iot1clickprojects/iot1clickprojectsiface | Package iot1clickprojectsiface provides an interface to enable mocking the AWS IoT 1-Click Projects Service service client for testing your code. |
| service/iotanalytics | Package iotanalytics provides the client and types for making API requests to AWS IoT Analytics. |
| service/iotanalytics/iotanalyticsiface | Package iotanalyticsiface provides an interface to enable mocking the AWS IoT Analytics service client for testing your code. |
| service/iotdataplane | Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane. |
| service/iotdataplane/iotdataplaneiface | Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code. |
| service/iot/iotiface | Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code. |
| service/iotjobsdataplane | Package iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane. |
| service/iotjobsdataplane/iotjobsdataplaneiface | Package iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code. |
| service/kinesis | Package kinesis provides the client and types for making API requests to Amazon Kinesis. |
| service/kinesisanalytics | Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics. |
| service/kinesisanalytics/kinesisanalyticsiface | Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code. |
| service/kinesis/kinesisiface | Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code. |
| service/kinesisvideo | Package kinesisvideo provides the client and types for making API requests to Amazon Kinesis Video Streams. |
| service/kinesisvideoarchivedmedia | Package kinesisvideoarchivedmedia provides the client and types for making API requests to Amazon Kinesis Video Streams Archived Media. |
| service/kinesisvideoarchivedmedia/kinesisvideoarchivedmediaiface | Package kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code. |
| service/kinesisvideo/kinesisvideoiface | Package kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code. |
| service/kinesisvideomedia | Package kinesisvideomedia provides the client and types for making API requests to Amazon Kinesis Video Streams Media. |
| service/kinesisvideomedia/kinesisvideomediaiface | Package kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code. |
| service/kms | Package kms provides the client and types for making API requests to AWS Key Management Service. |
| service/kms/kmsiface | Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code. |
| service/lambda | Package lambda provides the client and types for making API requests to AWS Lambda. |
| service/lambda/lambdaiface | Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code. |
| service/lexmodelbuildingservice | Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service. |
| service/lexmodelbuildingservice/lexmodelbuildingserviceiface | Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code. |
| service/lexruntimeservice | Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service. |
| service/lexruntimeservice/lexruntimeserviceiface | Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code. |
| service/lightsail | Package lightsail provides the client and types for making API requests to Amazon Lightsail. |
| service/lightsail/lightsailiface | Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code. |
| service/machinelearning | Package machinelearning provides the client and types for making API requests to Amazon Machine Learning. |
| service/machinelearning/machinelearningiface | Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code. |
| service/marketplacecommerceanalytics | Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics. |
| service/marketplacecommerceanalytics/marketplacecommerceanalyticsiface | Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code. |
| service/marketplaceentitlementservice | Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service. |
| service/marketplaceentitlementservice/marketplaceentitlementserviceiface | Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code. |
| service/marketplacemetering | Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering. |
| service/marketplacemetering/marketplacemeteringiface | Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code. |
| service/mediaconvert | Package mediaconvert provides the client and types for making API requests to AWS Elemental MediaConvert. |
| service/mediaconvert/mediaconvertiface | Package mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code. |
| service/medialive | Package medialive provides the client and types for making API requests to AWS Elemental MediaLive. |
| service/medialive/medialiveiface | Package medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code. |
| service/mediapackage | Package mediapackage provides the client and types for making API requests to AWS Elemental MediaPackage. |
| service/mediapackage/mediapackageiface | Package mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code. |
| service/mediastore | Package mediastore provides the client and types for making API requests to AWS Elemental MediaStore. |
| service/mediastoredata | Package mediastoredata provides the client and types for making API requests to AWS Elemental MediaStore Data Plane. |
| service/mediastoredata/mediastoredataiface | Package mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code. |
| service/mediastore/mediastoreiface | Package mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code. |
| service/migrationhub | Package migrationhub provides the client and types for making API requests to AWS Migration Hub. |
| service/migrationhub/migrationhubiface | Package migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code. |
| service/mobile | Package mobile provides the client and types for making API requests to AWS Mobile. |
| service/mobileanalytics | Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics. |
| service/mobileanalytics/mobileanalyticsiface | Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code. |
| service/mobile/mobileiface | Package mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code. |
| service/mq | Package mq provides the client and types for making API requests to AmazonMQ. |
| service/mq/mqiface | Package mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code. |
| service/mturk | Package mturk provides the client and types for making API requests to Amazon Mechanical Turk. |
| service/mturk/mturkiface | Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code. |
| service/opsworks | Package opsworks provides the client and types for making API requests to AWS OpsWorks. |
| service/opsworkscm | Package opsworkscm provides the client and types for making API requests to AWS OpsWorks for Chef Automate. |
| service/opsworkscm/opsworkscmiface | Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks for Chef Automate service client for testing your code. |
| service/opsworks/opsworksiface | Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code. |
| service/organizations | Package organizations provides the client and types for making API requests to AWS Organizations. |
| service/organizations/organizationsiface | Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code. |
| service/pinpoint | Package pinpoint provides the client and types for making API requests to Amazon Pinpoint. |
| service/pinpoint/pinpointiface | Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code. |
| service/polly | Package polly provides the client and types for making API requests to Amazon Polly. |
| service/polly/pollyiface | Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code. |
| service/pricing | Package pricing provides the client and types for making API requests to AWS Price List Service. |
| service/pricing/pricingiface | Package pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code. |
| service/rds | Package rds provides the client and types for making API requests to Amazon Relational Database Service. |
| service/rds/rdsiface | Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code. |
| service/rds/rdsutils | |
| service/redshift | Package redshift provides the client and types for making API requests to Amazon Redshift. |
| service/redshift/redshiftiface | Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code. |
| service/rekognition | Package rekognition provides the client and types for making API requests to Amazon Rekognition. |
| service/rekognition/rekognitioniface | Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code. |
| service/resourcegroups | Package resourcegroups provides the client and types for making API requests to AWS Resource Groups. |
| service/resourcegroups/resourcegroupsiface | Package resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code. |
| service/resourcegroupstaggingapi | Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API. |
| service/resourcegroupstaggingapi/resourcegroupstaggingapiiface | Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code. |
| service/route53 | Package route53 provides the client and types for making API requests to Amazon Route 53. |
| service/route53domains | Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains. |
| service/route53domains/route53domainsiface | Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code. |
| service/route53/route53iface | Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code. |
| service/s3 | Package s3 provides the client and types for making API requests to Amazon Simple Storage Service. |
| service/s3/s3crypto | Package s3crypto provides encryption to S3 using KMS and AES GCM. |
| service/s3/s3iface | Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code. |
| service/s3/s3manager | Package s3manager provides utilities to upload and download objects from S3 concurrently. |
| service/s3/s3manager/s3manageriface | Package s3manageriface provides an interface for the s3manager package |
| service/sagemaker | Package sagemaker provides the client and types for making API requests to Amazon SageMaker Service. |
| service/sagemakerruntime | Package sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime. |
| service/sagemakerruntime/sagemakerruntimeiface | Package sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code. |
| service/sagemaker/sagemakeriface | Package sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code. |
| service/secretsmanager | Package secretsmanager provides the client and types for making API requests to AWS Secrets Manager. |
| service/secretsmanager/secretsmanageriface | Package secretsmanageriface provides an interface to enable mocking the AWS Secrets Manager service client for testing your code. |
| service/serverlessapplicationrepository | Package serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository. |
| service/serverlessapplicationrepository/serverlessapplicationrepositoryiface | Package serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code. |
| service/servicecatalog | Package servicecatalog provides the client and types for making API requests to AWS Service Catalog. |
| service/servicecatalog/servicecatalogiface | Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code. |
| service/servicediscovery | Package servicediscovery provides the client and types for making API requests to Amazon Route 53 Auto Naming. |
| service/servicediscovery/servicediscoveryiface | Package servicediscoveryiface provides an interface to enable mocking the Amazon Route 53 Auto Naming service client for testing your code. |
| service/ses | Package ses provides the client and types for making API requests to Amazon Simple Email Service. |
| service/ses/sesiface | Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code. |
| service/sfn | Package sfn provides the client and types for making API requests to AWS Step Functions. |
| service/sfn/sfniface | Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code. |
| service/shield | Package shield provides the client and types for making API requests to AWS Shield. |
| service/shield/shieldiface | Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code. |
| service/simpledb | Package simpledb provides the client and types for making API requests to Amazon SimpleDB. |
| service/simpledb/simpledbiface | Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code. |
| service/sms | Package sms provides the client and types for making API requests to AWS Server Migration Service. |
| service/sms/smsiface | Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code. |
| service/snowball | Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball. |
| service/snowball/snowballiface | Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code. |
| service/sns | Package sns provides the client and types for making API requests to Amazon Simple Notification Service. |
| service/sns/snsiface | Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code. |
| service/sqs | Package sqs provides the client and types for making API requests to Amazon Simple Queue Service. |
| service/sqs/sqsiface | Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code. |
| service/ssm | Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM). |
| service/ssm/ssmiface | Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code. |
| service/storagegateway | Package storagegateway provides the client and types for making API requests to AWS Storage Gateway. |
| service/storagegateway/storagegatewayiface | Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code. |
| service/sts | Package sts provides the client and types for making API requests to AWS Security Token Service. |
| service/sts/stsiface | Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code. |
| service/support | Package support provides the client and types for making API requests to AWS Support. |
| service/support/supportiface | Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code. |
| service/swf | Package swf provides the client and types for making API requests to Amazon Simple Workflow Service. |
| service/swf/swfiface | Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code. |
| service/transcribeservice | Package transcribeservice provides the client and types for making API requests to Amazon Transcribe Service. |
| service/transcribeservice/transcribeserviceiface | Package transcribeserviceiface provides an interface to enable mocking the Amazon Transcribe Service service client for testing your code. |
| service/translate | Package translate provides the client and types for making API requests to Amazon Translate. |
| service/translate/translateiface | Package translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code. |
| service/waf | Package waf provides the client and types for making API requests to AWS WAF. |
| service/wafregional | Package wafregional provides the client and types for making API requests to AWS WAF Regional. |
| service/wafregional/wafregionaliface | Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code. |
| service/waf/wafiface | Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code. |
| service/workdocs | Package workdocs provides the client and types for making API requests to Amazon WorkDocs. |
| service/workdocs/workdocsiface | Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code. |
| service/workmail | Package workmail provides the client and types for making API requests to Amazon WorkMail. |
| service/workmail/workmailiface | Package workmailiface provides an interface to enable mocking the Amazon WorkMail service client for testing your code. |
| service/workspaces | Package workspaces provides the client and types for making API requests to Amazon WorkSpaces. |
| service/workspaces/workspacesiface | Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code. |
| service/xray | Package xray provides the client and types for making API requests to AWS X-Ray. |
| service/xray/xrayiface | Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code. |
- Version
- v2.0.0-preview.4+incompatible
- Published
- May 26, 2018
- Platform
- darwin/amd64
- Last checked
- 6 minutes ago –
Tools for package owners.