package sdk
import "github.com/aws/aws-sdk-go-v2"
Package sdk is the official AWS SDK for the Go programming language.
The AWS SDK for Go provides APIs and utilities that developers can use to build Go applications that use AWS services, such as Amazon Elastic Compute Cloud (Amazon EC2) and Amazon Simple Storage Service (Amazon S3).
The SDK removes the complexity of coding directly against a web service interface. It hides a lot of the lower-level plumbing, such as authentication, request retries, and error handling.
The SDK also includes helpful utilities on top of the AWS APIs that add additional capabilities and functionality. For example, the Amazon S3 Download and Upload Manager will automatically split up large objects into multiple parts and transfer them concurrently.
See the s3manager package documentation for more information. https://docs.aws.amazon.com/sdk-for-go/api/service/s3/s3manager/
Getting More Information
Checkout the Getting Started Guide and API Reference Docs detailed the SDK's components and details on each AWS client the SDK supports.
The Getting Started Guide provides examples and detailed description of how to get setup with the SDK. https://docs.aws.amazon.com/sdk-for-go/v1/developer-guide/welcome.html
The API Reference Docs include a detailed breakdown of the SDK's components such as utilities and AWS clients. Use this as a reference of the Go types included with the SDK, such as AWS clients, API operations, and API parameters. https://docs.aws.amazon.com/sdk-for-go/api/
Overview of SDK's Packages
The SDK is composed of two main components, SDK core, and service clients. The SDK core packages are all available under the aws package at the root of the SDK. Each client for a supported AWS service is available within its own package under the service folder at the root of the SDK.
aws - SDK core, provides common shared types such as Config, Logger, and utilities to make working with API parameters easier.
awserr - Provides the error interface that the SDK will use for all errors that occur in the SDK's processing. This includes service API response errors as well. The Error type is made up of a code and message. Cast the SDK's returned error type to awserr.Error and call the Code method to compare returned error to specific error codes. See the package's documentation for additional values that can be extracted such as RequestId.
credentials - Provides the types and built in credentials providers the SDK will use to retrieve AWS credentials to make API requests with. Nested under this folder are also additional credentials providers such as stscreds for assuming IAM roles, and ec2rolecreds for EC2 Instance roles.
endpoints - Provides the AWS Regions and Endpoints metadata for the SDK. Use this to lookup AWS service endpoint information such as which services are in a region, and what regions a service is in. Constants are also provided for all region identifiers, e.g UsWest2RegionID for "us-west-2".
session - Provides initial default configuration, and load configuration from external sources such as environment and shared credentials file.
request - Provides the API request sending, and retry logic for the SDK. This package also includes utilities for defining your own request retryer, and configuring how the SDK processes the request.
service - Clients for AWS services. All services supported by the SDK are available under this folder.
How to Use the SDK's AWS Service Clients
The SDK includes the Go types and utilities you can use to make requests to AWS service APIs. Within the service folder at the root of the SDK you'll find a package for each AWS service the SDK supports. All service clients follows a common pattern of creation and usage.
When creating a client for an AWS service you'll first need to have a Session value constructed. The Session provides shared configuration that can be shared between your service clients. When service clients are created you can pass in additional configuration via the aws.Config type to override configuration provided by in the Session to create service client instances with custom configuration.
Once the service's client is created you can use it to make API requests the AWS service. These clients are safe to use concurrently.
Configuring the SDK
In the AWS SDK for Go, you can configure settings for service clients, such as the log level and maximum number of retries. Most settings are optional; however, for each service client, you must specify a region and your credentials. The SDK uses these values to send requests to the correct AWS region and sign requests with the correct credentials. You can specify these values as part of a session or as environment variables.
See the SDK's configuration guide for more information. https://docs.aws.amazon.com/sdk-for-go/v1/developer-guide/configuring-sdk.html
See the session package documentation for more information on how to use Session with the SDK. https://docs.aws.amazon.com/sdk-for-go/api/aws/session/
See the Config type in the aws package for more information on configuration options. https://docs.aws.amazon.com/sdk-for-go/api/aws/#Config
Configuring Credentials
When using the SDK you'll generally need your AWS credentials to authenticate with AWS services. The SDK supports multiple methods of supporting these credentials. By default the SDK will source credentials automatically from its default credential chain. See the session package for more information on this chain, and how to configure it. The common items in the credential chain are the following:
Environment Credentials - Set of environment variables that are useful when sub processes are created for specific roles.
Shared Credentials file (~/.aws/credentials) - This file stores your credentials based on a profile name and is useful for local development.
EC2 Instance Role Credentials - Use EC2 Instance Role to assign credentials to application running on an EC2 instance. This removes the need to manage credential files in production.
Credentials can be configured in code as well by setting the Config's Credentials value to a custom provider or using one of the providers included with the SDK to bypass the default credential chain and use a custom one. This is helpful when you want to instruct the SDK to only use a specific set of credentials or providers.
This example creates a credential provider for assuming an IAM role, "myRoleARN" and configures the S3 service client to use that role for API requests.
// Initial credentials loaded from SDK's default credential chain. Such as
// the environment, shared credentials (~/.aws/credentials), or EC2 Instance
// Role. These credentials will be used to to make the STS Assume Role API.
sess := session.Must(session.NewSession())
// Create the credentials from AssumeRoleProvider to assume the role
// referenced by the "myRoleARN" ARN.
creds := stscreds.NewCredentials(sess, "myRoleArn")
// Create service client value configured for credentials
// from assumed role.
svc := s3.New(sess, &aws.Config{Credentials: creds})/
See the credentials package documentation for more information on credential providers included with the SDK, and how to customize the SDK's usage of credentials. https://docs.aws.amazon.com/sdk-for-go/api/aws/credentials
The SDK has support for the shared configuration file (~/.aws/config). This support can be enabled by setting the environment variable, "AWS_SDK_LOAD_CONFIG=1", or enabling the feature in code when creating a Session via the Option's SharedConfigState parameter.
sess := session.Must(session.NewSessionWithOptions(session.Options{
SharedConfigState: session.SharedConfigEnable,
}))
Configuring AWS Region
In addition to the credentials you'll need to specify the region the SDK will use to make AWS API requests to. In the SDK you can specify the region either with an environment variable, or directly in code when a Session or service client is created. The last value specified in code wins if the region is specified multiple ways.
To set the region via the environment variable set the "AWS_REGION" to the region you want to the SDK to use. Using this method to set the region will allow you to run your application in multiple regions without needing additional code in the application to select the region.
AWS_REGION=us-west-2
The endpoints package includes constants for all regions the SDK knows. The values are all suffixed with RegionID. These values are helpful, because they reduce the need to type the region string manually.
To set the region on a Session use the aws package's Config struct parameter Region to the AWS region you want the service clients created from the session to use. This is helpful when you want to create multiple service clients, and all of the clients make API requests to the same region.
sess := session.Must(session.NewSession(&aws.Config{
Region: aws.String(endpoints.UsWest2RegionID),
}))
See the endpoints package for the AWS Regions and Endpoints metadata. https://docs.aws.amazon.com/sdk-for-go/api/aws/endpoints/
In addition to setting the region when creating a Session you can also set the region on a per service client bases. This overrides the region of a Session. This is helpful when you want to create service clients in specific regions different from the Session's region.
svc := s3.New(sess, &aws.Config{
Region: aws.String(ednpoints.UsWest2RegionID),
})
See the Config type in the aws package for more information and additional options such as setting the Endpoint, and other service client configuration options. https://docs.aws.amazon.com/sdk-for-go/api/aws/#Config
Making API Requests
Once the client is created you can make an API request to the service. Each API method takes a input parameter, and returns the service response and an error. The SDK provides methods for making the API call in multiple ways.
In this list we'll use the S3 ListObjects API as an example for the different ways of making API requests.
ListObjects - Base API operation that will make the API request to the service.
ListObjectsRequest - API methods suffixed with Request will construct the API request, but not send it. This is also helpful when you want to get a presigned URL for a request, and share the presigned URL instead of your application making the request directly.
ListObjectsPages - Same as the base API operation, but uses a callback to automatically handle pagination of the API's response.
ListObjectsWithContext - Same as base API operation, but adds support for the Context pattern. This is helpful for controlling the canceling of in flight requests. See the Go standard library context package for more information. This method also takes request package's Option functional options as the variadic argument for modifying how the request will be made, or extracting information from the raw HTTP response.
ListObjectsPagesWithContext - same as ListObjectsPages, but adds support for the Context pattern. Similar to ListObjectsWithContext this method also takes the request package's Option function option types as the variadic argument.
In addition to the API operations the SDK also includes several higher level methods that abstract checking for and waiting for an AWS resource to be in a desired state. In this list we'll use WaitUntilBucketExists to demonstrate the different forms of waiters.
WaitUntilBucketExists. - Method to make API request to query an AWS service for a resource's state. Will return successfully when that state is accomplished.
WaitUntilBucketExistsWithContext - Same as WaitUntilBucketExists, but adds support for the Context pattern. In addition these methods take request package's WaiterOptions to configure the waiter, and how underlying request will be made by the SDK.
The API method will document which error codes the service might return for the operation. These errors will also be available as const strings prefixed with "ErrCode" in the service client's package. If there are no errors listed in the API's SDK documentation you'll need to consult the AWS service's API documentation for the errors that could be returned.
ctx := context.Background()
result, err := svc.GetObjectWithContext(ctx, &s3.GetObjectInput{
Bucket: aws.String("my-bucket"),
Key: aws.String("my-key"),
})
if err != nil {
// Cast err to awserr.Error to handle specific error codes.
aerr, ok := err.(awserr.Error)
if ok && aerr.Code() == s3.ErrCodeNoSuchKey {
// Specific error code handling
}
return err
}
// Make sure to close the body when done with it for S3 GetObject APIs or
// will leak connections.
defer result.Body.Close()
fmt.Println("Object Size:", aws.StringValue(result.ContentLength))
API Request Pagination and Resource Waiters
Pagination helper methods are suffixed with "Pages", and provide the functionality needed to round trip API page requests. Pagination methods take a callback function that will be called for each page of the API's response.
objects := []string{}
err := svc.ListObjectsPagesWithContext(ctx, &s3.ListObjectsInput{
Bucket: aws.String(myBucket),
}, func(p *s3.ListObjectsOutput, lastPage bool) bool {
for _, o := range p.Contents {
objects = append(objects, aws.StringValue(o.Key))
}
return true // continue paging
})
if err != nil {
panic(fmt.Sprintf("failed to list objects for bucket, %s, %v", myBucket, err))
}
fmt.Println("Objects in bucket:", objects)
Waiter helper methods provide the functionality to wait for an AWS resource state. These methods abstract the logic needed to to check the state of an AWS resource, and wait until that resource is in a desired state. The waiter will block until the resource is in the state that is desired, an error occurs, or the waiter times out. If a resource times out the error code returned will be request.WaiterResourceNotReadyErrorCode.
err := svc.WaitUntilBucketExistsWithContext(ctx, &s3.HeadBucketInput{
Bucket: aws.String(myBucket),
})
if err != nil {
aerr, ok := err.(awserr.Error)
if ok && aerr.Code() == request.WaiterResourceNotReadyErrorCode {
fmt.Fprintf(os.Stderr, "timed out while waiting for bucket to exist")
}
panic(fmt.Errorf("failed to wait for bucket to exist, %v", err))
}
fmt.Println("Bucket", myBucket, "exists")
Complete SDK Example
This example shows a complete working Go file which will upload a file to S3 and use the Context pattern to implement timeout logic that will cancel the request if it takes too long. This example highlights how to use sessions, create a service client, make a request, handle the error, and process the response.
package main
import (
"context"
"flag"
"fmt"
"os"
"time"
"github.com/aws/aws-sdk-go-v2/aws"
"github.com/aws/aws-sdk-go-v2/aws/awserr"
request "github.com/aws/aws-sdk-go-v2/aws"
"github.com/aws/aws-sdk-go-v2/aws/session"
"github.com/aws/aws-sdk-go-v2/service/s3"
)
// Uploads a file to S3 given a bucket and object key. Also takes a duration
// value to terminate the update if it doesn't complete within that time.
//
// The AWS Region needs to be provided in the AWS shared config or on the
// environment variable as `AWS_REGION`. Credentials also must be provided
// Will default to shared config file, but can load from environment if provided.
//
// Usage:
// # Upload myfile.txt to myBucket/myKey. Must complete within 10 minutes or will fail
// go run withContext.go -b mybucket -k myKey -d 10m < myfile.txt
func main() {
var bucket, key string
var timeout time.Duration
flag.StringVar(&bucket, "b", "", "Bucket name.")
flag.StringVar(&key, "k", "", "Object key name.")
flag.DurationVar(&timeout, "d", 0, "Upload timeout.")
flag.Parse()
// All clients require a Session. The Session provides the client with
// shared configuration such as region, endpoint, and credentials. A
// Session should be shared where possible to take advantage of
// configuration and credential caching. See the session package for
// more information.
sess := session.Must(session.NewSession())
// Create a new instance of the service's client with a Session.
// Optional aws.Config values can also be provided as variadic arguments
// to the New function. This option allows you to provide service
// specific configuration.
svc := s3.New(sess)
// Create a context with a timeout that will abort the upload if it takes
// more than the passed in timeout.
ctx := context.Background()
var cancelFn func()
if timeout > 0 {
ctx, cancelFn = context.WithTimeout(ctx, timeout)
}
// Ensure the context is canceled to prevent leaking.
// See context package for more information, https://golang.org/pkg/context/
defer cancelFn()
// Uploads the object to S3. The Context will interrupt the request if the
// timeout expires.
_, err := svc.PutObjectWithContext(ctx, &s3.PutObjectInput{
Bucket: aws.String(bucket),
Key: aws.String(key),
Body: os.Stdin,
})
if err != nil {
if aerr, ok := err.(awserr.Error); ok && aerr.Code() == request.CanceledErrorCode {
// If the SDK can determine the request or retry delay was canceled
// by a context the CanceledErrorCode error code will be returned.
fmt.Fprintf(os.Stderr, "upload canceled due to timeout, %v\n", err)
} else {
fmt.Fprintf(os.Stderr, "failed to upload object, %v\n", err)
}
os.Exit(1)
}
fmt.Printf("successfully uploaded file to %s/%s\n", bucket, key)
}
Index ¶
Source Files ¶
Directories ¶
| Path | Synopsis |
|---|---|
| aws | Package aws provides the core SDK's utilities and shared types. |
| aws/arn | Package arn provides a parser for interacting with Amazon Resource Names. |
| aws/awserr | Package awserr represents API error interface accessors for the SDK. |
| aws/defaults | Package defaults is a collection of helpers to retrieve the SDK's default configuration and handlers. |
| aws/ec2metadata | Package ec2metadata provides the client for making API calls to the EC2 Metadata service. |
| aws/ec2rolecreds | |
| aws/endpointcreds | Package endpointcreds provides support for retrieving credentials from an arbitrary HTTP endpoint. |
| aws/endpoints | Package endpoints provides the types and functionality for defining regions and endpoints, as well as querying those definitions. |
| aws/external | |
| aws/plugincreds | Package plugincreds implements a credentials provider sourced from a Go plugin. |
| aws/signer | |
| aws/signer/v2 | |
| aws/signer/v4 | Package v4 implements signing for AWS V4 signer |
| aws/stscreds | Package stscreds are credential Providers to retrieve STS AWS credentials. |
| internal | |
| models | |
| models/endpoints | Package endpoints contains the models for endpoints that should be used to generate endpoint definition files for the SDK. |
| private | |
| private/protocol | |
| private/protocol/ec2query | Package ec2query provides serialization of AWS EC2 requests and responses. |
| private/protocol/json | |
| private/protocol/json/jsonutil | Package jsonutil provides JSON serialization of AWS requests and responses. |
| private/protocol/jsonrpc | Package jsonrpc provides JSON RPC utilities for serialization of AWS requests and responses. |
| private/protocol/query | Package query provides serialization of AWS query requests, and responses. |
| private/protocol/query/queryutil | |
| private/protocol/rest | Package rest provides RESTful serialization of AWS requests and responses. |
| private/protocol/restjson | Package restjson provides RESTful JSON serialization of AWS requests and responses. |
| private/protocol/restxml | Package restxml provides RESTful XML serialization of AWS requests and responses. |
| private/protocol/xml | |
| private/protocol/xml/xmlutil | Package xmlutil provides XML serialization of AWS requests and responses. |
| private/util | |
| service | Package service contains automatically generated AWS clients. |
| service/acm | Package acm provides the client and types for making API requests to AWS Certificate Manager. |
| service/acm/acmiface | Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code. |
| service/apigateway | Package apigateway provides the client and types for making API requests to Amazon API Gateway. |
| service/apigateway/apigatewayiface | Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code. |
| service/applicationautoscaling | Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling. |
| service/applicationautoscaling/applicationautoscalingiface | Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code. |
| service/applicationdiscoveryservice | Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service. |
| service/applicationdiscoveryservice/applicationdiscoveryserviceiface | Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code. |
| service/appstream | Package appstream provides the client and types for making API requests to Amazon AppStream. |
| service/appstream/appstreamiface | Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code. |
| service/athena | Package athena provides the client and types for making API requests to Amazon Athena. |
| service/athena/athenaiface | Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code. |
| service/autoscaling | Package autoscaling provides the client and types for making API requests to Auto Scaling. |
| service/autoscaling/autoscalingiface | Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code. |
| service/batch | Package batch provides the client and types for making API requests to AWS Batch. |
| service/batch/batchiface | Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code. |
| service/budgets | Package budgets provides the client and types for making API requests to AWS Budgets. |
| service/budgets/budgetsiface | Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code. |
| service/clouddirectory | Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory. |
| service/clouddirectory/clouddirectoryiface | Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code. |
| service/cloudformation | Package cloudformation provides the client and types for making API requests to AWS CloudFormation. |
| service/cloudformation/cloudformationiface | Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code. |
| service/cloudfront | Package cloudfront provides the client and types for making API requests to Amazon CloudFront. |
| service/cloudfront/cloudfrontiface | Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code. |
| service/cloudfront/sign | Package sign provides utilities to generate signed URLs for Amazon CloudFront. |
| service/cloudhsm | Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM. |
| service/cloudhsm/cloudhsmiface | Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code. |
| service/cloudhsmv2 | Package cloudhsmv2 provides the client and types for making API requests to AWS CloudHSM V2. |
| service/cloudhsmv2/cloudhsmv2iface | Package cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code. |
| service/cloudsearch | Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch. |
| service/cloudsearch/cloudsearchiface | Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code. |
| service/cloudsearchdomain | Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain. |
| service/cloudsearchdomain/cloudsearchdomainiface | Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code. |
| service/cloudtrail | Package cloudtrail provides the client and types for making API requests to AWS CloudTrail. |
| service/cloudtrail/cloudtrailiface | Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code. |
| service/cloudwatch | Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch. |
| service/cloudwatch/cloudwatchiface | Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code. |
| service/cloudwatchevents | Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events. |
| service/cloudwatchevents/cloudwatcheventsiface | Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code. |
| service/cloudwatchlogs | Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs. |
| service/cloudwatchlogs/cloudwatchlogsiface | Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code. |
| service/codebuild | Package codebuild provides the client and types for making API requests to AWS CodeBuild. |
| service/codebuild/codebuildiface | Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code. |
| service/codecommit | Package codecommit provides the client and types for making API requests to AWS CodeCommit. |
| service/codecommit/codecommitiface | Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code. |
| service/codedeploy | Package codedeploy provides the client and types for making API requests to AWS CodeDeploy. |
| service/codedeploy/codedeployiface | Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code. |
| service/codepipeline | Package codepipeline provides the client and types for making API requests to AWS CodePipeline. |
| service/codepipeline/codepipelineiface | Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code. |
| service/codestar | Package codestar provides the client and types for making API requests to AWS CodeStar. |
| service/codestar/codestariface | Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code. |
| service/cognitoidentity | Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity. |
| service/cognitoidentity/cognitoidentityiface | Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code. |
| service/cognitoidentityprovider | Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider. |
| service/cognitoidentityprovider/cognitoidentityprovideriface | Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code. |
| service/cognitosync | Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync. |
| service/cognitosync/cognitosynciface | Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code. |
| service/configservice | Package configservice provides the client and types for making API requests to AWS Config. |
| service/configservice/configserviceiface | Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code. |
| service/costandusagereportservice | Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service. |
| service/costandusagereportservice/costandusagereportserviceiface | Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code. |
| service/databasemigrationservice | Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service. |
| service/databasemigrationservice/databasemigrationserviceiface | Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code. |
| service/datapipeline | Package datapipeline provides the client and types for making API requests to AWS Data Pipeline. |
| service/datapipeline/datapipelineiface | Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code. |
| service/dax | Package dax provides the client and types for making API requests to Amazon DynamoDB Accelerator (DAX). |
| service/dax/daxiface | Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code. |
| service/devicefarm | Package devicefarm provides the client and types for making API requests to AWS Device Farm. |
| service/devicefarm/devicefarmiface | Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code. |
| service/directconnect | Package directconnect provides the client and types for making API requests to AWS Direct Connect. |
| service/directconnect/directconnectiface | Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code. |
| service/directoryservice | Package directoryservice provides the client and types for making API requests to AWS Directory Service. |
| service/directoryservice/directoryserviceiface | Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code. |
| service/dynamodb | Package dynamodb provides the client and types for making API requests to Amazon DynamoDB. |
| service/dynamodb/dynamodbattribute | Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues. |
| service/dynamodb/dynamodbiface | Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code. |
| service/dynamodb/expression | Package expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps. |
| service/dynamodbstreams | Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams. |
| service/dynamodbstreams/dynamodbstreamsiface | Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code. |
| service/ec2 | Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud. |
| service/ec2/ec2iface | Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code. |
| service/ecr | Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry. |
| service/ecr/ecriface | Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code. |
| service/ecs | Package ecs provides the client and types for making API requests to Amazon EC2 Container Service. |
| service/ecs/ecsiface | Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code. |
| service/efs | Package efs provides the client and types for making API requests to Amazon Elastic File System. |
| service/efs/efsiface | Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code. |
| service/elasticache | Package elasticache provides the client and types for making API requests to Amazon ElastiCache. |
| service/elasticache/elasticacheiface | Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code. |
| service/elasticbeanstalk | Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk. |
| service/elasticbeanstalk/elasticbeanstalkiface | Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code. |
| service/elasticsearchservice | Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service. |
| service/elasticsearchservice/elasticsearchserviceiface | Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code. |
| service/elastictranscoder | Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder. |
| service/elastictranscoder/elastictranscoderiface | Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code. |
| service/elb | Package elb provides the client and types for making API requests to Elastic Load Balancing. |
| service/elb/elbiface | Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. |
| service/elbv2 | Package elbv2 provides the client and types for making API requests to Elastic Load Balancing. |
| service/elbv2/elbv2iface | Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. |
| service/emr | Package emr provides the client and types for making API requests to Amazon Elastic MapReduce. |
| service/emr/emriface | Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code. |
| service/firehose | Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose. |
| service/firehose/firehoseiface | Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code. |
| service/gamelift | Package gamelift provides the client and types for making API requests to Amazon GameLift. |
| service/gamelift/gameliftiface | Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code. |
| service/glacier | Package glacier provides the client and types for making API requests to Amazon Glacier. |
| service/glacier/glacieriface | Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code. |
| service/glue | Package glue provides the client and types for making API requests to AWS Glue. |
| service/glue/glueiface | Package glueiface provides an interface to enable mocking the AWS Glue service client for testing your code. |
| service/greengrass | Package greengrass provides the client and types for making API requests to AWS Greengrass. |
| service/greengrass/greengrassiface | Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code. |
| service/health | Package health provides the client and types for making API requests to AWS Health APIs and Notifications. |
| service/health/healthiface | Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code. |
| service/iam | Package iam provides the client and types for making API requests to AWS Identity and Access Management. |
| service/iam/iamiface | Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code. |
| service/inspector | Package inspector provides the client and types for making API requests to Amazon Inspector. |
| service/inspector/inspectoriface | Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code. |
| service/iot | Package iot provides the client and types for making API requests to AWS IoT. |
| service/iotdataplane | Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane. |
| service/iotdataplane/iotdataplaneiface | Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code. |
| service/iot/iotiface | Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code. |
| service/kinesis | Package kinesis provides the client and types for making API requests to Amazon Kinesis. |
| service/kinesisanalytics | Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics. |
| service/kinesisanalytics/kinesisanalyticsiface | Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code. |
| service/kinesis/kinesisiface | Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code. |
| service/kms | Package kms provides the client and types for making API requests to AWS Key Management Service. |
| service/kms/kmsiface | Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code. |
| service/lambda | Package lambda provides the client and types for making API requests to AWS Lambda. |
| service/lambda/lambdaiface | Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code. |
| service/lexmodelbuildingservice | Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service. |
| service/lexmodelbuildingservice/lexmodelbuildingserviceiface | Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code. |
| service/lexruntimeservice | Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service. |
| service/lexruntimeservice/lexruntimeserviceiface | Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code. |
| service/lightsail | Package lightsail provides the client and types for making API requests to Amazon Lightsail. |
| service/lightsail/lightsailiface | Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code. |
| service/machinelearning | Package machinelearning provides the client and types for making API requests to Amazon Machine Learning. |
| service/machinelearning/machinelearningiface | Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code. |
| service/marketplacecommerceanalytics | Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics. |
| service/marketplacecommerceanalytics/marketplacecommerceanalyticsiface | Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code. |
| service/marketplaceentitlementservice | Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service. |
| service/marketplaceentitlementservice/marketplaceentitlementserviceiface | Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code. |
| service/marketplacemetering | Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering. |
| service/marketplacemetering/marketplacemeteringiface | Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code. |
| service/migrationhub | Package migrationhub provides the client and types for making API requests to AWS Migration Hub. |
| service/migrationhub/migrationhubiface | Package migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code. |
| service/mobile | Package mobile provides the client and types for making API requests to AWS Mobile. |
| service/mobileanalytics | Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics. |
| service/mobileanalytics/mobileanalyticsiface | Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code. |
| service/mobile/mobileiface | Package mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code. |
| service/mturk | Package mturk provides the client and types for making API requests to Amazon Mechanical Turk. |
| service/mturk/mturkiface | Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code. |
| service/opsworks | Package opsworks provides the client and types for making API requests to AWS OpsWorks. |
| service/opsworkscm | Package opsworkscm provides the client and types for making API requests to AWS OpsWorks for Chef Automate. |
| service/opsworkscm/opsworkscmiface | Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks for Chef Automate service client for testing your code. |
| service/opsworks/opsworksiface | Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code. |
| service/organizations | Package organizations provides the client and types for making API requests to AWS Organizations. |
| service/organizations/organizationsiface | Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code. |
| service/pinpoint | Package pinpoint provides the client and types for making API requests to Amazon Pinpoint. |
| service/pinpoint/pinpointiface | Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code. |
| service/polly | Package polly provides the client and types for making API requests to Amazon Polly. |
| service/polly/pollyiface | Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code. |
| service/rds | Package rds provides the client and types for making API requests to Amazon Relational Database Service. |
| service/rds/rdsiface | Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code. |
| service/rds/rdsutils | |
| service/redshift | Package redshift provides the client and types for making API requests to Amazon Redshift. |
| service/redshift/redshiftiface | Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code. |
| service/rekognition | Package rekognition provides the client and types for making API requests to Amazon Rekognition. |
| service/rekognition/rekognitioniface | Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code. |
| service/resourcegroupstaggingapi | Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API. |
| service/resourcegroupstaggingapi/resourcegroupstaggingapiiface | Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code. |
| service/route53 | Package route53 provides the client and types for making API requests to Amazon Route 53. |
| service/route53domains | Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains. |
| service/route53domains/route53domainsiface | Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code. |
| service/route53/route53iface | Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code. |
| service/s3 | Package s3 provides the client and types for making API requests to Amazon Simple Storage Service. |
| service/s3/s3crypto | Package s3crypto provides encryption to S3 using KMS and AES GCM. |
| service/s3/s3iface | Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code. |
| service/s3/s3manager | Package s3manager provides utilities to upload and download objects from S3 concurrently. |
| service/s3/s3manager/s3manageriface | Package s3manageriface provides an interface for the s3manager package |
| service/servicecatalog | Package servicecatalog provides the client and types for making API requests to AWS Service Catalog. |
| service/servicecatalog/servicecatalogiface | Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code. |
| service/ses | Package ses provides the client and types for making API requests to Amazon Simple Email Service. |
| service/ses/sesiface | Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code. |
| service/sfn | Package sfn provides the client and types for making API requests to AWS Step Functions. |
| service/sfn/sfniface | Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code. |
| service/shield | Package shield provides the client and types for making API requests to AWS Shield. |
| service/shield/shieldiface | Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code. |
| service/simpledb | Package simpledb provides the client and types for making API requests to Amazon SimpleDB. |
| service/simpledb/simpledbiface | Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code. |
| service/sms | Package sms provides the client and types for making API requests to AWS Server Migration Service. |
| service/sms/smsiface | Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code. |
| service/snowball | Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball. |
| service/snowball/snowballiface | Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code. |
| service/sns | Package sns provides the client and types for making API requests to Amazon Simple Notification Service. |
| service/sns/snsiface | Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code. |
| service/sqs | Package sqs provides the client and types for making API requests to Amazon Simple Queue Service. |
| service/sqs/sqsiface | Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code. |
| service/ssm | Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM). |
| service/ssm/ssmiface | Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code. |
| service/storagegateway | Package storagegateway provides the client and types for making API requests to AWS Storage Gateway. |
| service/storagegateway/storagegatewayiface | Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code. |
| service/sts | Package sts provides the client and types for making API requests to AWS Security Token Service. |
| service/sts/stsiface | Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code. |
| service/support | Package support provides the client and types for making API requests to AWS Support. |
| service/support/supportiface | Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code. |
| service/swf | Package swf provides the client and types for making API requests to Amazon Simple Workflow Service. |
| service/swf/swfiface | Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code. |
| service/waf | Package waf provides the client and types for making API requests to AWS WAF. |
| service/wafregional | Package wafregional provides the client and types for making API requests to AWS WAF Regional. |
| service/wafregional/wafregionaliface | Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code. |
| service/waf/wafiface | Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code. |
| service/workdocs | Package workdocs provides the client and types for making API requests to Amazon WorkDocs. |
| service/workdocs/workdocsiface | Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code. |
| service/workspaces | Package workspaces provides the client and types for making API requests to Amazon WorkSpaces. |
| service/workspaces/workspacesiface | Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code. |
| service/xray | Package xray provides the client and types for making API requests to AWS X-Ray. |
| service/xray/xrayiface | Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code. |
- Version
- v2.0.0-preview.1+incompatible
- Published
- Dec 21, 2017
- Platform
- linux/amd64
- Last checked
- now –
Tools for package owners.