package service

import "github.com/aws/aws-sdk-go-v2/service"

Package service contains automatically generated AWS clients.

Index

Source Files

generate.go

Directories

PathSynopsis
service/acmPackage acm provides the client and types for making API requests to AWS Certificate Manager.
service/acm/acmifacePackage acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code.
service/acmpcaPackage acmpca provides the client and types for making API requests to AWS Certificate Manager Private Certificate Authority.
service/acmpca/acmpcaifacePackage acmpcaiface provides an interface to enable mocking the AWS Certificate Manager Private Certificate Authority service client for testing your code.
service/alexaforbusinessPackage alexaforbusiness provides the client and types for making API requests to Alexa For Business.
service/alexaforbusiness/alexaforbusinessifacePackage alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code.
service/apigatewayPackage apigateway provides the client and types for making API requests to Amazon API Gateway.
service/apigateway/apigatewayifacePackage apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code.
service/applicationautoscalingPackage applicationautoscaling provides the client and types for making API requests to Application Auto Scaling.
service/applicationautoscaling/applicationautoscalingifacePackage applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code.
service/applicationdiscoveryservicePackage applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service.
service/applicationdiscoveryservice/applicationdiscoveryserviceifacePackage applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code.
service/appstreamPackage appstream provides the client and types for making API requests to Amazon AppStream.
service/appstream/appstreamifacePackage appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code.
service/appsyncPackage appsync provides the client and types for making API requests to AWS AppSync.
service/appsync/appsyncifacePackage appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code.
service/athenaPackage athena provides the client and types for making API requests to Amazon Athena.
service/athena/athenaifacePackage athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code.
service/autoscalingPackage autoscaling provides the client and types for making API requests to Auto Scaling.
service/autoscaling/autoscalingifacePackage autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code.
service/autoscalingplansPackage autoscalingplans provides the client and types for making API requests to AWS Auto Scaling Plans.
service/autoscalingplans/autoscalingplansifacePackage autoscalingplansiface provides an interface to enable mocking the AWS Auto Scaling Plans service client for testing your code.
service/batchPackage batch provides the client and types for making API requests to AWS Batch.
service/batch/batchifacePackage batchiface provides an interface to enable mocking the AWS Batch service client for testing your code.
service/budgetsPackage budgets provides the client and types for making API requests to AWS Budgets.
service/budgets/budgetsifacePackage budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code.
service/cloud9Package cloud9 provides the client and types for making API requests to AWS Cloud9.
service/cloud9/cloud9ifacePackage cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code.
service/clouddirectoryPackage clouddirectory provides the client and types for making API requests to Amazon CloudDirectory.
service/clouddirectory/clouddirectoryifacePackage clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code.
service/cloudformationPackage cloudformation provides the client and types for making API requests to AWS CloudFormation.
service/cloudformation/cloudformationifacePackage cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code.
service/cloudfrontPackage cloudfront provides the client and types for making API requests to Amazon CloudFront.
service/cloudfront/cloudfrontifacePackage cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code.
service/cloudfront/signPackage sign provides utilities to generate signed URLs for Amazon CloudFront.
service/cloudhsmPackage cloudhsm provides the client and types for making API requests to Amazon CloudHSM.
service/cloudhsm/cloudhsmifacePackage cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code.
service/cloudhsmv2Package cloudhsmv2 provides the client and types for making API requests to AWS CloudHSM V2.
service/cloudhsmv2/cloudhsmv2ifacePackage cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code.
service/cloudsearchPackage cloudsearch provides the client and types for making API requests to Amazon CloudSearch.
service/cloudsearch/cloudsearchifacePackage cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code.
service/cloudsearchdomainPackage cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain.
service/cloudsearchdomain/cloudsearchdomainifacePackage cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code.
service/cloudtrailPackage cloudtrail provides the client and types for making API requests to AWS CloudTrail.
service/cloudtrail/cloudtrailifacePackage cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code.
service/cloudwatchPackage cloudwatch provides the client and types for making API requests to Amazon CloudWatch.
service/cloudwatch/cloudwatchifacePackage cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code.
service/cloudwatcheventsPackage cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events.
service/cloudwatchevents/cloudwatcheventsifacePackage cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code.
service/cloudwatchlogsPackage cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs.
service/cloudwatchlogs/cloudwatchlogsifacePackage cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code.
service/codebuildPackage codebuild provides the client and types for making API requests to AWS CodeBuild.
service/codebuild/codebuildifacePackage codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code.
service/codecommitPackage codecommit provides the client and types for making API requests to AWS CodeCommit.
service/codecommit/codecommitifacePackage codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code.
service/codedeployPackage codedeploy provides the client and types for making API requests to AWS CodeDeploy.
service/codedeploy/codedeployifacePackage codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code.
service/codepipelinePackage codepipeline provides the client and types for making API requests to AWS CodePipeline.
service/codepipeline/codepipelineifacePackage codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code.
service/codestarPackage codestar provides the client and types for making API requests to AWS CodeStar.
service/codestar/codestarifacePackage codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code.
service/cognitoidentityPackage cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity.
service/cognitoidentity/cognitoidentityifacePackage cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code.
service/cognitoidentityproviderPackage cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider.
service/cognitoidentityprovider/cognitoidentityproviderifacePackage cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code.
service/cognitosyncPackage cognitosync provides the client and types for making API requests to Amazon Cognito Sync.
service/cognitosync/cognitosyncifacePackage cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code.
service/comprehendPackage comprehend provides the client and types for making API requests to Amazon Comprehend.
service/comprehend/comprehendifacePackage comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code.
service/configservicePackage configservice provides the client and types for making API requests to AWS Config.
service/configservice/configserviceifacePackage configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code.
service/connectPackage connect provides the client and types for making API requests to Amazon Connect Service.
service/connect/connectifacePackage connectiface provides an interface to enable mocking the Amazon Connect Service service client for testing your code.
service/costandusagereportservicePackage costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service.
service/costandusagereportservice/costandusagereportserviceifacePackage costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code.
service/costexplorerPackage costexplorer provides the client and types for making API requests to AWS Cost Explorer Service.
service/costexplorer/costexplorerifacePackage costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code.
service/databasemigrationservicePackage databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service.
service/databasemigrationservice/databasemigrationserviceifacePackage databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code.
service/datapipelinePackage datapipeline provides the client and types for making API requests to AWS Data Pipeline.
service/datapipeline/datapipelineifacePackage datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code.
service/daxPackage dax provides the client and types for making API requests to Amazon DynamoDB Accelerator (DAX).
service/dax/daxifacePackage daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code.
service/devicefarmPackage devicefarm provides the client and types for making API requests to AWS Device Farm.
service/devicefarm/devicefarmifacePackage devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code.
service/directconnectPackage directconnect provides the client and types for making API requests to AWS Direct Connect.
service/directconnect/directconnectifacePackage directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code.
service/directoryservicePackage directoryservice provides the client and types for making API requests to AWS Directory Service.
service/directoryservice/directoryserviceifacePackage directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code.
service/dynamodbPackage dynamodb provides the client and types for making API requests to Amazon DynamoDB.
service/dynamodb/dynamodbattributePackage dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues.
service/dynamodb/dynamodbifacePackage dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code.
service/dynamodb/expressionPackage expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps.
service/dynamodbstreamsPackage dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams.
service/dynamodbstreams/dynamodbstreamsifacePackage dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code.
service/ec2Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud.
service/ec2/ec2ifacePackage ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code.
service/ecrPackage ecr provides the client and types for making API requests to Amazon EC2 Container Registry.
service/ecr/ecrifacePackage ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code.
service/ecsPackage ecs provides the client and types for making API requests to Amazon EC2 Container Service.
service/ecs/ecsifacePackage ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code.
service/efsPackage efs provides the client and types for making API requests to Amazon Elastic File System.
service/efs/efsifacePackage efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code.
service/elasticachePackage elasticache provides the client and types for making API requests to Amazon ElastiCache.
service/elasticache/elasticacheifacePackage elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code.
service/elasticbeanstalkPackage elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk.
service/elasticbeanstalk/elasticbeanstalkifacePackage elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code.
service/elasticsearchservicePackage elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service.
service/elasticsearchservice/elasticsearchserviceifacePackage elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code.
service/elastictranscoderPackage elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder.
service/elastictranscoder/elastictranscoderifacePackage elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code.
service/elbPackage elb provides the client and types for making API requests to Elastic Load Balancing.
service/elb/elbifacePackage elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
service/elbv2Package elbv2 provides the client and types for making API requests to Elastic Load Balancing.
service/elbv2/elbv2ifacePackage elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code.
service/emrPackage emr provides the client and types for making API requests to Amazon Elastic MapReduce.
service/emr/emrifacePackage emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code.
service/firehosePackage firehose provides the client and types for making API requests to Amazon Kinesis Firehose.
service/firehose/firehoseifacePackage firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code.
service/fmsPackage fms provides the client and types for making API requests to Firewall Management Service.
service/fms/fmsifacePackage fmsiface provides an interface to enable mocking the Firewall Management Service service client for testing your code.
service/gameliftPackage gamelift provides the client and types for making API requests to Amazon GameLift.
service/gamelift/gameliftifacePackage gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code.
service/glacierPackage glacier provides the client and types for making API requests to Amazon Glacier.
service/glacier/glacierifacePackage glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code.
service/gluePackage glue provides the client and types for making API requests to AWS Glue.
service/glue/glueifacePackage glueiface provides an interface to enable mocking the AWS Glue service client for testing your code.
service/greengrassPackage greengrass provides the client and types for making API requests to AWS Greengrass.
service/greengrass/greengrassifacePackage greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code.
service/guarddutyPackage guardduty provides the client and types for making API requests to Amazon GuardDuty.
service/guardduty/guarddutyifacePackage guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code.
service/healthPackage health provides the client and types for making API requests to AWS Health APIs and Notifications.
service/health/healthifacePackage healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code.
service/iamPackage iam provides the client and types for making API requests to AWS Identity and Access Management.
service/iam/iamifacePackage iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code.
service/inspectorPackage inspector provides the client and types for making API requests to Amazon Inspector.
service/inspector/inspectorifacePackage inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code.
service/iotPackage iot provides the client and types for making API requests to AWS IoT.
service/iot1clickdevicesservicePackage iot1clickdevicesservice provides the client and types for making API requests to AWS IoT 1-Click Devices Service.
service/iot1clickdevicesservice/iot1clickdevicesserviceifacePackage iot1clickdevicesserviceiface provides an interface to enable mocking the AWS IoT 1-Click Devices Service service client for testing your code.
service/iot1clickprojectsPackage iot1clickprojects provides the client and types for making API requests to AWS IoT 1-Click Projects Service.
service/iot1clickprojects/iot1clickprojectsifacePackage iot1clickprojectsiface provides an interface to enable mocking the AWS IoT 1-Click Projects Service service client for testing your code.
service/iotanalyticsPackage iotanalytics provides the client and types for making API requests to AWS IoT Analytics.
service/iotanalytics/iotanalyticsifacePackage iotanalyticsiface provides an interface to enable mocking the AWS IoT Analytics service client for testing your code.
service/iotdataplanePackage iotdataplane provides the client and types for making API requests to AWS IoT Data Plane.
service/iotdataplane/iotdataplaneifacePackage iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code.
service/iot/iotifacePackage iotiface provides an interface to enable mocking the AWS IoT service client for testing your code.
service/iotjobsdataplanePackage iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane.
service/iotjobsdataplane/iotjobsdataplaneifacePackage iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code.
service/kinesisPackage kinesis provides the client and types for making API requests to Amazon Kinesis.
service/kinesisanalyticsPackage kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics.
service/kinesisanalytics/kinesisanalyticsifacePackage kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code.
service/kinesis/kinesisifacePackage kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code.
service/kinesisvideoPackage kinesisvideo provides the client and types for making API requests to Amazon Kinesis Video Streams.
service/kinesisvideoarchivedmediaPackage kinesisvideoarchivedmedia provides the client and types for making API requests to Amazon Kinesis Video Streams Archived Media.
service/kinesisvideoarchivedmedia/kinesisvideoarchivedmediaifacePackage kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code.
service/kinesisvideo/kinesisvideoifacePackage kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code.
service/kinesisvideomediaPackage kinesisvideomedia provides the client and types for making API requests to Amazon Kinesis Video Streams Media.
service/kinesisvideomedia/kinesisvideomediaifacePackage kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code.
service/kmsPackage kms provides the client and types for making API requests to AWS Key Management Service.
service/kms/kmsifacePackage kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code.
service/lambdaPackage lambda provides the client and types for making API requests to AWS Lambda.
service/lambda/lambdaifacePackage lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code.
service/lexmodelbuildingservicePackage lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service.
service/lexmodelbuildingservice/lexmodelbuildingserviceifacePackage lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code.
service/lexruntimeservicePackage lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service.
service/lexruntimeservice/lexruntimeserviceifacePackage lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code.
service/lightsailPackage lightsail provides the client and types for making API requests to Amazon Lightsail.
service/lightsail/lightsailifacePackage lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code.
service/machinelearningPackage machinelearning provides the client and types for making API requests to Amazon Machine Learning.
service/machinelearning/machinelearningifacePackage machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code.
service/marketplacecommerceanalyticsPackage marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics.
service/marketplacecommerceanalytics/marketplacecommerceanalyticsifacePackage marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code.
service/marketplaceentitlementservicePackage marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service.
service/marketplaceentitlementservice/marketplaceentitlementserviceifacePackage marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code.
service/marketplacemeteringPackage marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering.
service/marketplacemetering/marketplacemeteringifacePackage marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code.
service/mediaconvertPackage mediaconvert provides the client and types for making API requests to AWS Elemental MediaConvert.
service/mediaconvert/mediaconvertifacePackage mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code.
service/medialivePackage medialive provides the client and types for making API requests to AWS Elemental MediaLive.
service/medialive/medialiveifacePackage medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code.
service/mediapackagePackage mediapackage provides the client and types for making API requests to AWS Elemental MediaPackage.
service/mediapackage/mediapackageifacePackage mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code.
service/mediastorePackage mediastore provides the client and types for making API requests to AWS Elemental MediaStore.
service/mediastoredataPackage mediastoredata provides the client and types for making API requests to AWS Elemental MediaStore Data Plane.
service/mediastoredata/mediastoredataifacePackage mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code.
service/mediastore/mediastoreifacePackage mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code.
service/migrationhubPackage migrationhub provides the client and types for making API requests to AWS Migration Hub.
service/migrationhub/migrationhubifacePackage migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code.
service/mobilePackage mobile provides the client and types for making API requests to AWS Mobile.
service/mobileanalyticsPackage mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics.
service/mobileanalytics/mobileanalyticsifacePackage mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code.
service/mobile/mobileifacePackage mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code.
service/mqPackage mq provides the client and types for making API requests to AmazonMQ.
service/mq/mqifacePackage mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code.
service/mturkPackage mturk provides the client and types for making API requests to Amazon Mechanical Turk.
service/mturk/mturkifacePackage mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code.
service/opsworksPackage opsworks provides the client and types for making API requests to AWS OpsWorks.
service/opsworkscmPackage opsworkscm provides the client and types for making API requests to AWS OpsWorks for Chef Automate.
service/opsworkscm/opsworkscmifacePackage opsworkscmiface provides an interface to enable mocking the AWS OpsWorks for Chef Automate service client for testing your code.
service/opsworks/opsworksifacePackage opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code.
service/organizationsPackage organizations provides the client and types for making API requests to AWS Organizations.
service/organizations/organizationsifacePackage organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code.
service/pinpointPackage pinpoint provides the client and types for making API requests to Amazon Pinpoint.
service/pinpoint/pinpointifacePackage pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code.
service/pollyPackage polly provides the client and types for making API requests to Amazon Polly.
service/polly/pollyifacePackage pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code.
service/pricingPackage pricing provides the client and types for making API requests to AWS Price List Service.
service/pricing/pricingifacePackage pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code.
service/rdsPackage rds provides the client and types for making API requests to Amazon Relational Database Service.
service/rds/rdsifacePackage rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code.
service/rds/rdsutils
service/redshiftPackage redshift provides the client and types for making API requests to Amazon Redshift.
service/redshift/redshiftifacePackage redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code.
service/rekognitionPackage rekognition provides the client and types for making API requests to Amazon Rekognition.
service/rekognition/rekognitionifacePackage rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code.
service/resourcegroupsPackage resourcegroups provides the client and types for making API requests to AWS Resource Groups.
service/resourcegroups/resourcegroupsifacePackage resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code.
service/resourcegroupstaggingapiPackage resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API.
service/resourcegroupstaggingapi/resourcegroupstaggingapiifacePackage resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code.
service/route53Package route53 provides the client and types for making API requests to Amazon Route 53.
service/route53domainsPackage route53domains provides the client and types for making API requests to Amazon Route 53 Domains.
service/route53domains/route53domainsifacePackage route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code.
service/route53/route53ifacePackage route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code.
service/s3Package s3 provides the client and types for making API requests to Amazon Simple Storage Service.
service/s3/s3cryptoPackage s3crypto provides encryption to S3 using KMS and AES GCM.
service/s3/s3ifacePackage s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code.
service/s3/s3managerPackage s3manager provides utilities to upload and download objects from S3 concurrently.
service/s3/s3manager/s3managerifacePackage s3manageriface provides an interface for the s3manager package
service/sagemakerPackage sagemaker provides the client and types for making API requests to Amazon SageMaker Service.
service/sagemakerruntimePackage sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime.
service/sagemakerruntime/sagemakerruntimeifacePackage sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code.
service/sagemaker/sagemakerifacePackage sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code.
service/secretsmanagerPackage secretsmanager provides the client and types for making API requests to AWS Secrets Manager.
service/secretsmanager/secretsmanagerifacePackage secretsmanageriface provides an interface to enable mocking the AWS Secrets Manager service client for testing your code.
service/serverlessapplicationrepositoryPackage serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository.
service/serverlessapplicationrepository/serverlessapplicationrepositoryifacePackage serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code.
service/servicecatalogPackage servicecatalog provides the client and types for making API requests to AWS Service Catalog.
service/servicecatalog/servicecatalogifacePackage servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code.
service/servicediscoveryPackage servicediscovery provides the client and types for making API requests to Amazon Route 53 Auto Naming.
service/servicediscovery/servicediscoveryifacePackage servicediscoveryiface provides an interface to enable mocking the Amazon Route 53 Auto Naming service client for testing your code.
service/sesPackage ses provides the client and types for making API requests to Amazon Simple Email Service.
service/ses/sesifacePackage sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code.
service/sfnPackage sfn provides the client and types for making API requests to AWS Step Functions.
service/sfn/sfnifacePackage sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code.
service/shieldPackage shield provides the client and types for making API requests to AWS Shield.
service/shield/shieldifacePackage shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code.
service/simpledbPackage simpledb provides the client and types for making API requests to Amazon SimpleDB.
service/simpledb/simpledbifacePackage simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code.
service/smsPackage sms provides the client and types for making API requests to AWS Server Migration Service.
service/sms/smsifacePackage smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code.
service/snowballPackage snowball provides the client and types for making API requests to Amazon Import/Export Snowball.
service/snowball/snowballifacePackage snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code.
service/snsPackage sns provides the client and types for making API requests to Amazon Simple Notification Service.
service/sns/snsifacePackage snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code.
service/sqsPackage sqs provides the client and types for making API requests to Amazon Simple Queue Service.
service/sqs/sqsifacePackage sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code.
service/ssmPackage ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM).
service/ssm/ssmifacePackage ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code.
service/storagegatewayPackage storagegateway provides the client and types for making API requests to AWS Storage Gateway.
service/storagegateway/storagegatewayifacePackage storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code.
service/stsPackage sts provides the client and types for making API requests to AWS Security Token Service.
service/sts/stsifacePackage stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code.
service/supportPackage support provides the client and types for making API requests to AWS Support.
service/support/supportifacePackage supportiface provides an interface to enable mocking the AWS Support service client for testing your code.
service/swfPackage swf provides the client and types for making API requests to Amazon Simple Workflow Service.
service/swf/swfifacePackage swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code.
service/transcribeservicePackage transcribeservice provides the client and types for making API requests to Amazon Transcribe Service.
service/transcribeservice/transcribeserviceifacePackage transcribeserviceiface provides an interface to enable mocking the Amazon Transcribe Service service client for testing your code.
service/translatePackage translate provides the client and types for making API requests to Amazon Translate.
service/translate/translateifacePackage translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code.
service/wafPackage waf provides the client and types for making API requests to AWS WAF.
service/wafregionalPackage wafregional provides the client and types for making API requests to AWS WAF Regional.
service/wafregional/wafregionalifacePackage wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code.
service/waf/wafifacePackage wafiface provides an interface to enable mocking the AWS WAF service client for testing your code.
service/workdocsPackage workdocs provides the client and types for making API requests to Amazon WorkDocs.
service/workdocs/workdocsifacePackage workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code.
service/workmailPackage workmail provides the client and types for making API requests to Amazon WorkMail.
service/workmail/workmailifacePackage workmailiface provides an interface to enable mocking the Amazon WorkMail service client for testing your code.
service/workspacesPackage workspaces provides the client and types for making API requests to Amazon WorkSpaces.
service/workspaces/workspacesifacePackage workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code.
service/xrayPackage xray provides the client and types for making API requests to AWS X-Ray.
service/xray/xrayifacePackage xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code.
Version
v2.0.0-preview.4+incompatible
Published
May 26, 2018
Platform
linux/amd64
Last checked
13 minutes ago

Tools for package owners.