package service
import "github.com/aws/aws-sdk-go-v2/service"
Package service contains automatically generated AWS clients.
Index ¶
Source Files ¶
Directories ¶
| Path | Synopsis |
|---|---|
| service/acm | Package acm provides the client and types for making API requests to AWS Certificate Manager. |
| service/acm/acmiface | Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code. |
| service/alexaforbusiness | Package alexaforbusiness provides the client and types for making API requests to Alexa For Business. |
| service/alexaforbusiness/alexaforbusinessiface | Package alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code. |
| service/apigateway | Package apigateway provides the client and types for making API requests to Amazon API Gateway. |
| service/apigateway/apigatewayiface | Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code. |
| service/applicationautoscaling | Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling. |
| service/applicationautoscaling/applicationautoscalingiface | Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code. |
| service/applicationdiscoveryservice | Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service. |
| service/applicationdiscoveryservice/applicationdiscoveryserviceiface | Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code. |
| service/appstream | Package appstream provides the client and types for making API requests to Amazon AppStream. |
| service/appstream/appstreamiface | Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code. |
| service/appsync | Package appsync provides the client and types for making API requests to AWS AppSync. |
| service/appsync/appsynciface | Package appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code. |
| service/athena | Package athena provides the client and types for making API requests to Amazon Athena. |
| service/athena/athenaiface | Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code. |
| service/autoscaling | Package autoscaling provides the client and types for making API requests to Auto Scaling. |
| service/autoscaling/autoscalingiface | Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code. |
| service/batch | Package batch provides the client and types for making API requests to AWS Batch. |
| service/batch/batchiface | Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code. |
| service/budgets | Package budgets provides the client and types for making API requests to AWS Budgets. |
| service/budgets/budgetsiface | Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code. |
| service/cloud9 | Package cloud9 provides the client and types for making API requests to AWS Cloud9. |
| service/cloud9/cloud9iface | Package cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code. |
| service/clouddirectory | Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory. |
| service/clouddirectory/clouddirectoryiface | Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code. |
| service/cloudformation | Package cloudformation provides the client and types for making API requests to AWS CloudFormation. |
| service/cloudformation/cloudformationiface | Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code. |
| service/cloudfront | Package cloudfront provides the client and types for making API requests to Amazon CloudFront. |
| service/cloudfront/cloudfrontiface | Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code. |
| service/cloudfront/sign | Package sign provides utilities to generate signed URLs for Amazon CloudFront. |
| service/cloudhsm | Package cloudhsm provides the client and types for making API requests to Amazon CloudHSM. |
| service/cloudhsm/cloudhsmiface | Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code. |
| service/cloudhsmv2 | Package cloudhsmv2 provides the client and types for making API requests to AWS CloudHSM V2. |
| service/cloudhsmv2/cloudhsmv2iface | Package cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code. |
| service/cloudsearch | Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch. |
| service/cloudsearch/cloudsearchiface | Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code. |
| service/cloudsearchdomain | Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain. |
| service/cloudsearchdomain/cloudsearchdomainiface | Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code. |
| service/cloudtrail | Package cloudtrail provides the client and types for making API requests to AWS CloudTrail. |
| service/cloudtrail/cloudtrailiface | Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code. |
| service/cloudwatch | Package cloudwatch provides the client and types for making API requests to Amazon CloudWatch. |
| service/cloudwatch/cloudwatchiface | Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code. |
| service/cloudwatchevents | Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events. |
| service/cloudwatchevents/cloudwatcheventsiface | Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code. |
| service/cloudwatchlogs | Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs. |
| service/cloudwatchlogs/cloudwatchlogsiface | Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code. |
| service/codebuild | Package codebuild provides the client and types for making API requests to AWS CodeBuild. |
| service/codebuild/codebuildiface | Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code. |
| service/codecommit | Package codecommit provides the client and types for making API requests to AWS CodeCommit. |
| service/codecommit/codecommitiface | Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code. |
| service/codedeploy | Package codedeploy provides the client and types for making API requests to AWS CodeDeploy. |
| service/codedeploy/codedeployiface | Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code. |
| service/codepipeline | Package codepipeline provides the client and types for making API requests to AWS CodePipeline. |
| service/codepipeline/codepipelineiface | Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code. |
| service/codestar | Package codestar provides the client and types for making API requests to AWS CodeStar. |
| service/codestar/codestariface | Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code. |
| service/cognitoidentity | Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity. |
| service/cognitoidentity/cognitoidentityiface | Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code. |
| service/cognitoidentityprovider | Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider. |
| service/cognitoidentityprovider/cognitoidentityprovideriface | Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code. |
| service/cognitosync | Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync. |
| service/cognitosync/cognitosynciface | Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code. |
| service/comprehend | Package comprehend provides the client and types for making API requests to Amazon Comprehend. |
| service/comprehend/comprehendiface | Package comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code. |
| service/configservice | Package configservice provides the client and types for making API requests to AWS Config. |
| service/configservice/configserviceiface | Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code. |
| service/costandusagereportservice | Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service. |
| service/costandusagereportservice/costandusagereportserviceiface | Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code. |
| service/costexplorer | Package costexplorer provides the client and types for making API requests to AWS Cost Explorer Service. |
| service/costexplorer/costexploreriface | Package costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code. |
| service/databasemigrationservice | Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service. |
| service/databasemigrationservice/databasemigrationserviceiface | Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code. |
| service/datapipeline | Package datapipeline provides the client and types for making API requests to AWS Data Pipeline. |
| service/datapipeline/datapipelineiface | Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code. |
| service/dax | Package dax provides the client and types for making API requests to Amazon DynamoDB Accelerator (DAX). |
| service/dax/daxiface | Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code. |
| service/devicefarm | Package devicefarm provides the client and types for making API requests to AWS Device Farm. |
| service/devicefarm/devicefarmiface | Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code. |
| service/directconnect | Package directconnect provides the client and types for making API requests to AWS Direct Connect. |
| service/directconnect/directconnectiface | Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code. |
| service/directoryservice | Package directoryservice provides the client and types for making API requests to AWS Directory Service. |
| service/directoryservice/directoryserviceiface | Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code. |
| service/dynamodb | Package dynamodb provides the client and types for making API requests to Amazon DynamoDB. |
| service/dynamodb/dynamodbattribute | Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues. |
| service/dynamodb/dynamodbiface | Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code. |
| service/dynamodb/expression | Package expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps. |
| service/dynamodbstreams | Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams. |
| service/dynamodbstreams/dynamodbstreamsiface | Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code. |
| service/ec2 | Package ec2 provides the client and types for making API requests to Amazon Elastic Compute Cloud. |
| service/ec2/ec2iface | Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code. |
| service/ecr | Package ecr provides the client and types for making API requests to Amazon EC2 Container Registry. |
| service/ecr/ecriface | Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code. |
| service/ecs | Package ecs provides the client and types for making API requests to Amazon EC2 Container Service. |
| service/ecs/ecsiface | Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code. |
| service/efs | Package efs provides the client and types for making API requests to Amazon Elastic File System. |
| service/efs/efsiface | Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code. |
| service/elasticache | Package elasticache provides the client and types for making API requests to Amazon ElastiCache. |
| service/elasticache/elasticacheiface | Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code. |
| service/elasticbeanstalk | Package elasticbeanstalk provides the client and types for making API requests to AWS Elastic Beanstalk. |
| service/elasticbeanstalk/elasticbeanstalkiface | Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code. |
| service/elasticsearchservice | Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service. |
| service/elasticsearchservice/elasticsearchserviceiface | Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code. |
| service/elastictranscoder | Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder. |
| service/elastictranscoder/elastictranscoderiface | Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code. |
| service/elb | Package elb provides the client and types for making API requests to Elastic Load Balancing. |
| service/elb/elbiface | Package elbiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. |
| service/elbv2 | Package elbv2 provides the client and types for making API requests to Elastic Load Balancing. |
| service/elbv2/elbv2iface | Package elbv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. |
| service/emr | Package emr provides the client and types for making API requests to Amazon Elastic MapReduce. |
| service/emr/emriface | Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code. |
| service/firehose | Package firehose provides the client and types for making API requests to Amazon Kinesis Firehose. |
| service/firehose/firehoseiface | Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code. |
| service/gamelift | Package gamelift provides the client and types for making API requests to Amazon GameLift. |
| service/gamelift/gameliftiface | Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code. |
| service/glacier | Package glacier provides the client and types for making API requests to Amazon Glacier. |
| service/glacier/glacieriface | Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code. |
| service/glue | Package glue provides the client and types for making API requests to AWS Glue. |
| service/glue/glueiface | Package glueiface provides an interface to enable mocking the AWS Glue service client for testing your code. |
| service/greengrass | Package greengrass provides the client and types for making API requests to AWS Greengrass. |
| service/greengrass/greengrassiface | Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code. |
| service/guardduty | Package guardduty provides the client and types for making API requests to Amazon GuardDuty. |
| service/guardduty/guarddutyiface | Package guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code. |
| service/health | Package health provides the client and types for making API requests to AWS Health APIs and Notifications. |
| service/health/healthiface | Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code. |
| service/iam | Package iam provides the client and types for making API requests to AWS Identity and Access Management. |
| service/iam/iamiface | Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code. |
| service/inspector | Package inspector provides the client and types for making API requests to Amazon Inspector. |
| service/inspector/inspectoriface | Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code. |
| service/iot | Package iot provides the client and types for making API requests to AWS IoT. |
| service/iotdataplane | Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane. |
| service/iotdataplane/iotdataplaneiface | Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code. |
| service/iot/iotiface | Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code. |
| service/iotjobsdataplane | Package iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane. |
| service/iotjobsdataplane/iotjobsdataplaneiface | Package iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code. |
| service/kinesis | Package kinesis provides the client and types for making API requests to Amazon Kinesis. |
| service/kinesisanalytics | Package kinesisanalytics provides the client and types for making API requests to Amazon Kinesis Analytics. |
| service/kinesisanalytics/kinesisanalyticsiface | Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code. |
| service/kinesis/kinesisiface | Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code. |
| service/kinesisvideo | Package kinesisvideo provides the client and types for making API requests to Amazon Kinesis Video Streams. |
| service/kinesisvideoarchivedmedia | Package kinesisvideoarchivedmedia provides the client and types for making API requests to Amazon Kinesis Video Streams Archived Media. |
| service/kinesisvideoarchivedmedia/kinesisvideoarchivedmediaiface | Package kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code. |
| service/kinesisvideo/kinesisvideoiface | Package kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code. |
| service/kinesisvideomedia | Package kinesisvideomedia provides the client and types for making API requests to Amazon Kinesis Video Streams Media. |
| service/kinesisvideomedia/kinesisvideomediaiface | Package kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code. |
| service/kms | Package kms provides the client and types for making API requests to AWS Key Management Service. |
| service/kms/kmsiface | Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code. |
| service/lambda | Package lambda provides the client and types for making API requests to AWS Lambda. |
| service/lambda/lambdaiface | Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code. |
| service/lexmodelbuildingservice | Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service. |
| service/lexmodelbuildingservice/lexmodelbuildingserviceiface | Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code. |
| service/lexruntimeservice | Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service. |
| service/lexruntimeservice/lexruntimeserviceiface | Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code. |
| service/lightsail | Package lightsail provides the client and types for making API requests to Amazon Lightsail. |
| service/lightsail/lightsailiface | Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code. |
| service/machinelearning | Package machinelearning provides the client and types for making API requests to Amazon Machine Learning. |
| service/machinelearning/machinelearningiface | Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code. |
| service/marketplacecommerceanalytics | Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics. |
| service/marketplacecommerceanalytics/marketplacecommerceanalyticsiface | Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code. |
| service/marketplaceentitlementservice | Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service. |
| service/marketplaceentitlementservice/marketplaceentitlementserviceiface | Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code. |
| service/marketplacemetering | Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering. |
| service/marketplacemetering/marketplacemeteringiface | Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code. |
| service/mediaconvert | Package mediaconvert provides the client and types for making API requests to AWS Elemental MediaConvert. |
| service/mediaconvert/mediaconvertiface | Package mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code. |
| service/medialive | Package medialive provides the client and types for making API requests to AWS Elemental MediaLive. |
| service/medialive/medialiveiface | Package medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code. |
| service/mediapackage | Package mediapackage provides the client and types for making API requests to AWS Elemental MediaPackage. |
| service/mediapackage/mediapackageiface | Package mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code. |
| service/mediastore | Package mediastore provides the client and types for making API requests to AWS Elemental MediaStore. |
| service/mediastoredata | Package mediastoredata provides the client and types for making API requests to AWS Elemental MediaStore Data Plane. |
| service/mediastoredata/mediastoredataiface | Package mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code. |
| service/mediastore/mediastoreiface | Package mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code. |
| service/migrationhub | Package migrationhub provides the client and types for making API requests to AWS Migration Hub. |
| service/migrationhub/migrationhubiface | Package migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code. |
| service/mobile | Package mobile provides the client and types for making API requests to AWS Mobile. |
| service/mobileanalytics | Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics. |
| service/mobileanalytics/mobileanalyticsiface | Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code. |
| service/mobile/mobileiface | Package mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code. |
| service/mq | Package mq provides the client and types for making API requests to AmazonMQ. |
| service/mq/mqiface | Package mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code. |
| service/mturk | Package mturk provides the client and types for making API requests to Amazon Mechanical Turk. |
| service/mturk/mturkiface | Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code. |
| service/opsworks | Package opsworks provides the client and types for making API requests to AWS OpsWorks. |
| service/opsworkscm | Package opsworkscm provides the client and types for making API requests to AWS OpsWorks for Chef Automate. |
| service/opsworkscm/opsworkscmiface | Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks for Chef Automate service client for testing your code. |
| service/opsworks/opsworksiface | Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code. |
| service/organizations | Package organizations provides the client and types for making API requests to AWS Organizations. |
| service/organizations/organizationsiface | Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code. |
| service/pinpoint | Package pinpoint provides the client and types for making API requests to Amazon Pinpoint. |
| service/pinpoint/pinpointiface | Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code. |
| service/polly | Package polly provides the client and types for making API requests to Amazon Polly. |
| service/polly/pollyiface | Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code. |
| service/pricing | Package pricing provides the client and types for making API requests to AWS Price List Service. |
| service/pricing/pricingiface | Package pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code. |
| service/rds | Package rds provides the client and types for making API requests to Amazon Relational Database Service. |
| service/rds/rdsiface | Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code. |
| service/rds/rdsutils | |
| service/redshift | Package redshift provides the client and types for making API requests to Amazon Redshift. |
| service/redshift/redshiftiface | Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code. |
| service/rekognition | Package rekognition provides the client and types for making API requests to Amazon Rekognition. |
| service/rekognition/rekognitioniface | Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code. |
| service/resourcegroups | Package resourcegroups provides the client and types for making API requests to AWS Resource Groups. |
| service/resourcegroups/resourcegroupsiface | Package resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code. |
| service/resourcegroupstaggingapi | Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API. |
| service/resourcegroupstaggingapi/resourcegroupstaggingapiiface | Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code. |
| service/route53 | Package route53 provides the client and types for making API requests to Amazon Route 53. |
| service/route53domains | Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains. |
| service/route53domains/route53domainsiface | Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code. |
| service/route53/route53iface | Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code. |
| service/s3 | Package s3 provides the client and types for making API requests to Amazon Simple Storage Service. |
| service/s3/s3crypto | Package s3crypto provides encryption to S3 using KMS and AES GCM. |
| service/s3/s3iface | Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code. |
| service/s3/s3manager | Package s3manager provides utilities to upload and download objects from S3 concurrently. |
| service/s3/s3manager/s3manageriface | Package s3manageriface provides an interface for the s3manager package |
| service/sagemaker | Package sagemaker provides the client and types for making API requests to Amazon SageMaker Service. |
| service/sagemakerruntime | Package sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime. |
| service/sagemakerruntime/sagemakerruntimeiface | Package sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code. |
| service/sagemaker/sagemakeriface | Package sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code. |
| service/serverlessapplicationrepository | Package serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository. |
| service/serverlessapplicationrepository/serverlessapplicationrepositoryiface | Package serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code. |
| service/servicecatalog | Package servicecatalog provides the client and types for making API requests to AWS Service Catalog. |
| service/servicecatalog/servicecatalogiface | Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code. |
| service/servicediscovery | Package servicediscovery provides the client and types for making API requests to Amazon Route 53 Auto Naming. |
| service/servicediscovery/servicediscoveryiface | Package servicediscoveryiface provides an interface to enable mocking the Amazon Route 53 Auto Naming service client for testing your code. |
| service/ses | Package ses provides the client and types for making API requests to Amazon Simple Email Service. |
| service/ses/sesiface | Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code. |
| service/sfn | Package sfn provides the client and types for making API requests to AWS Step Functions. |
| service/sfn/sfniface | Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code. |
| service/shield | Package shield provides the client and types for making API requests to AWS Shield. |
| service/shield/shieldiface | Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code. |
| service/simpledb | Package simpledb provides the client and types for making API requests to Amazon SimpleDB. |
| service/simpledb/simpledbiface | Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code. |
| service/sms | Package sms provides the client and types for making API requests to AWS Server Migration Service. |
| service/sms/smsiface | Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code. |
| service/snowball | Package snowball provides the client and types for making API requests to Amazon Import/Export Snowball. |
| service/snowball/snowballiface | Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code. |
| service/sns | Package sns provides the client and types for making API requests to Amazon Simple Notification Service. |
| service/sns/snsiface | Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code. |
| service/sqs | Package sqs provides the client and types for making API requests to Amazon Simple Queue Service. |
| service/sqs/sqsiface | Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code. |
| service/ssm | Package ssm provides the client and types for making API requests to Amazon Simple Systems Manager (SSM). |
| service/ssm/ssmiface | Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code. |
| service/storagegateway | Package storagegateway provides the client and types for making API requests to AWS Storage Gateway. |
| service/storagegateway/storagegatewayiface | Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code. |
| service/sts | Package sts provides the client and types for making API requests to AWS Security Token Service. |
| service/sts/stsiface | Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code. |
| service/support | Package support provides the client and types for making API requests to AWS Support. |
| service/support/supportiface | Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code. |
| service/swf | Package swf provides the client and types for making API requests to Amazon Simple Workflow Service. |
| service/swf/swfiface | Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code. |
| service/translate | Package translate provides the client and types for making API requests to Amazon Translate. |
| service/translate/translateiface | Package translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code. |
| service/waf | Package waf provides the client and types for making API requests to AWS WAF. |
| service/wafregional | Package wafregional provides the client and types for making API requests to AWS WAF Regional. |
| service/wafregional/wafregionaliface | Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code. |
| service/waf/wafiface | Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code. |
| service/workdocs | Package workdocs provides the client and types for making API requests to Amazon WorkDocs. |
| service/workdocs/workdocsiface | Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code. |
| service/workmail | Package workmail provides the client and types for making API requests to Amazon WorkMail. |
| service/workmail/workmailiface | Package workmailiface provides an interface to enable mocking the Amazon WorkMail service client for testing your code. |
| service/workspaces | Package workspaces provides the client and types for making API requests to Amazon WorkSpaces. |
| service/workspaces/workspacesiface | Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code. |
| service/xray | Package xray provides the client and types for making API requests to AWS X-Ray. |
| service/xray/xrayiface | Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code. |
- Version
- v2.0.0-preview.2+incompatible
- Published
- Jan 15, 2018
- Platform
- linux/amd64
- Last checked
- 17 minutes ago –
Tools for package owners.