package service
import "github.com/aws/aws-sdk-go-v2/service"
Package service contains automatically generated AWS clients.
Index ¶
Source Files ¶
Directories ¶
Path | Synopsis |
---|---|
service/acm | Package acm provides the client and types for making API requests to ACM. |
service/acm/acmiface | Package acmiface provides an interface to enable mocking the AWS Certificate Manager service client for testing your code. |
service/acmpca | Package acmpca provides the client and types for making API requests to ACM-PCA. |
service/acmpca/acmpcaiface | Package acmpcaiface provides an interface to enable mocking the AWS Certificate Manager Private Certificate Authority service client for testing your code. |
service/alexaforbusiness | Package alexaforbusiness provides the client and types for making API requests to Alexa For Business. |
service/alexaforbusiness/alexaforbusinessiface | Package alexaforbusinessiface provides an interface to enable mocking the Alexa For Business service client for testing your code. |
service/amplify | Package amplify provides the client and types for making API requests to Amplify. |
service/amplify/amplifyiface | Package amplifyiface provides an interface to enable mocking the AWS Amplify service client for testing your code. |
service/apigateway | Package apigateway provides the client and types for making API requests to Amazon API Gateway. |
service/apigateway/apigatewayiface | Package apigatewayiface provides an interface to enable mocking the Amazon API Gateway service client for testing your code. |
service/apigatewaymanagementapi | Package apigatewaymanagementapi provides the client and types for making API requests to AmazonApiGatewayManagementApi. |
service/apigatewaymanagementapi/apigatewaymanagementapiiface | Package apigatewaymanagementapiiface provides an interface to enable mocking the AmazonApiGatewayManagementApi service client for testing your code. |
service/apigatewayv2 | Package apigatewayv2 provides the client and types for making API requests to AmazonApiGatewayV2. |
service/apigatewayv2/apigatewayv2iface | Package apigatewayv2iface provides an interface to enable mocking the AmazonApiGatewayV2 service client for testing your code. |
service/applicationautoscaling | Package applicationautoscaling provides the client and types for making API requests to Application Auto Scaling. |
service/applicationautoscaling/applicationautoscalingiface | Package applicationautoscalingiface provides an interface to enable mocking the Application Auto Scaling service client for testing your code. |
service/applicationdiscoveryservice | Package applicationdiscoveryservice provides the client and types for making API requests to AWS Application Discovery Service. |
service/applicationdiscoveryservice/applicationdiscoveryserviceiface | Package applicationdiscoveryserviceiface provides an interface to enable mocking the AWS Application Discovery Service service client for testing your code. |
service/applicationinsights | Package applicationinsights provides the client and types for making API requests to Application Insights. |
service/applicationinsights/applicationinsightsiface | Package applicationinsightsiface provides an interface to enable mocking the Amazon CloudWatch Application Insights service client for testing your code. |
service/appmesh | Package appmesh provides the client and types for making API requests to AWS App Mesh. |
service/appmesh/appmeshiface | Package appmeshiface provides an interface to enable mocking the AWS App Mesh service client for testing your code. |
service/appstream | Package appstream provides the client and types for making API requests to Amazon AppStream. |
service/appstream/appstreamiface | Package appstreamiface provides an interface to enable mocking the Amazon AppStream service client for testing your code. |
service/appsync | Package appsync provides the client and types for making API requests to AWSAppSync. |
service/appsync/appsynciface | Package appsynciface provides an interface to enable mocking the AWS AppSync service client for testing your code. |
service/athena | Package athena provides the client and types for making API requests to Amazon Athena. |
service/athena/athenaiface | Package athenaiface provides an interface to enable mocking the Amazon Athena service client for testing your code. |
service/autoscaling | Package autoscaling provides the client and types for making API requests to Auto Scaling. |
service/autoscaling/autoscalingiface | Package autoscalingiface provides an interface to enable mocking the Auto Scaling service client for testing your code. |
service/autoscalingplans | Package autoscalingplans provides the client and types for making API requests to AWS Auto Scaling Plans. |
service/autoscalingplans/autoscalingplansiface | Package autoscalingplansiface provides an interface to enable mocking the AWS Auto Scaling Plans service client for testing your code. |
service/backup | Package backup provides the client and types for making API requests to AWS Backup. |
service/backup/backupiface | Package backupiface provides an interface to enable mocking the AWS Backup service client for testing your code. |
service/batch | Package batch provides the client and types for making API requests to AWS Batch. |
service/batch/batchiface | Package batchiface provides an interface to enable mocking the AWS Batch service client for testing your code. |
service/budgets | Package budgets provides the client and types for making API requests to AWSBudgets. |
service/budgets/budgetsiface | Package budgetsiface provides an interface to enable mocking the AWS Budgets service client for testing your code. |
service/chime | Package chime provides the client and types for making API requests to Amazon Chime. |
service/chime/chimeiface | Package chimeiface provides an interface to enable mocking the Amazon Chime service client for testing your code. |
service/cloud9 | Package cloud9 provides the client and types for making API requests to AWS Cloud9. |
service/cloud9/cloud9iface | Package cloud9iface provides an interface to enable mocking the AWS Cloud9 service client for testing your code. |
service/clouddirectory | Package clouddirectory provides the client and types for making API requests to Amazon CloudDirectory. |
service/clouddirectory/clouddirectoryiface | Package clouddirectoryiface provides an interface to enable mocking the Amazon CloudDirectory service client for testing your code. |
service/cloudformation | Package cloudformation provides the client and types for making API requests to AWS CloudFormation. |
service/cloudformation/cloudformationiface | Package cloudformationiface provides an interface to enable mocking the AWS CloudFormation service client for testing your code. |
service/cloudfront | Package cloudfront provides the client and types for making API requests to CloudFront. |
service/cloudfront/cloudfrontiface | Package cloudfrontiface provides an interface to enable mocking the Amazon CloudFront service client for testing your code. |
service/cloudfront/sign | Package sign provides utilities to generate signed URLs for Amazon CloudFront. |
service/cloudhsm | Package cloudhsm provides the client and types for making API requests to CloudHSM. |
service/cloudhsm/cloudhsmiface | Package cloudhsmiface provides an interface to enable mocking the Amazon CloudHSM service client for testing your code. |
service/cloudhsmv2 | Package cloudhsmv2 provides the client and types for making API requests to CloudHSM V2. |
service/cloudhsmv2/cloudhsmv2iface | Package cloudhsmv2iface provides an interface to enable mocking the AWS CloudHSM V2 service client for testing your code. |
service/cloudsearch | Package cloudsearch provides the client and types for making API requests to Amazon CloudSearch. |
service/cloudsearch/cloudsearchiface | Package cloudsearchiface provides an interface to enable mocking the Amazon CloudSearch service client for testing your code. |
service/cloudsearchdomain | Package cloudsearchdomain provides the client and types for making API requests to Amazon CloudSearch Domain. |
service/cloudsearchdomain/cloudsearchdomainiface | Package cloudsearchdomainiface provides an interface to enable mocking the Amazon CloudSearch Domain service client for testing your code. |
service/cloudtrail | Package cloudtrail provides the client and types for making API requests to CloudTrail. |
service/cloudtrail/cloudtrailiface | Package cloudtrailiface provides an interface to enable mocking the AWS CloudTrail service client for testing your code. |
service/cloudwatch | Package cloudwatch provides the client and types for making API requests to CloudWatch. |
service/cloudwatch/cloudwatchiface | Package cloudwatchiface provides an interface to enable mocking the Amazon CloudWatch service client for testing your code. |
service/cloudwatchevents | Package cloudwatchevents provides the client and types for making API requests to Amazon CloudWatch Events. |
service/cloudwatchevents/cloudwatcheventsiface | Package cloudwatcheventsiface provides an interface to enable mocking the Amazon CloudWatch Events service client for testing your code. |
service/cloudwatchlogs | Package cloudwatchlogs provides the client and types for making API requests to Amazon CloudWatch Logs. |
service/cloudwatchlogs/cloudwatchlogsiface | Package cloudwatchlogsiface provides an interface to enable mocking the Amazon CloudWatch Logs service client for testing your code. |
service/codebuild | Package codebuild provides the client and types for making API requests to AWS CodeBuild. |
service/codebuild/codebuildiface | Package codebuildiface provides an interface to enable mocking the AWS CodeBuild service client for testing your code. |
service/codecommit | Package codecommit provides the client and types for making API requests to CodeCommit. |
service/codecommit/codecommitiface | Package codecommitiface provides an interface to enable mocking the AWS CodeCommit service client for testing your code. |
service/codedeploy | Package codedeploy provides the client and types for making API requests to CodeDeploy. |
service/codedeploy/codedeployiface | Package codedeployiface provides an interface to enable mocking the AWS CodeDeploy service client for testing your code. |
service/codepipeline | Package codepipeline provides the client and types for making API requests to CodePipeline. |
service/codepipeline/codepipelineiface | Package codepipelineiface provides an interface to enable mocking the AWS CodePipeline service client for testing your code. |
service/codestar | Package codestar provides the client and types for making API requests to CodeStar. |
service/codestar/codestariface | Package codestariface provides an interface to enable mocking the AWS CodeStar service client for testing your code. |
service/cognitoidentity | Package cognitoidentity provides the client and types for making API requests to Amazon Cognito Identity. |
service/cognitoidentity/cognitoidentityiface | Package cognitoidentityiface provides an interface to enable mocking the Amazon Cognito Identity service client for testing your code. |
service/cognitoidentityprovider | Package cognitoidentityprovider provides the client and types for making API requests to Amazon Cognito Identity Provider. |
service/cognitoidentityprovider/cognitoidentityprovideriface | Package cognitoidentityprovideriface provides an interface to enable mocking the Amazon Cognito Identity Provider service client for testing your code. |
service/cognitosync | Package cognitosync provides the client and types for making API requests to Amazon Cognito Sync. |
service/cognitosync/cognitosynciface | Package cognitosynciface provides an interface to enable mocking the Amazon Cognito Sync service client for testing your code. |
service/comprehend | Package comprehend provides the client and types for making API requests to Amazon Comprehend. |
service/comprehend/comprehendiface | Package comprehendiface provides an interface to enable mocking the Amazon Comprehend service client for testing your code. |
service/comprehendmedical | Package comprehendmedical provides the client and types for making API requests to ComprehendMedical. |
service/comprehendmedical/comprehendmedicaliface | Package comprehendmedicaliface provides an interface to enable mocking the AWS Comprehend Medical service client for testing your code. |
service/configservice | Package configservice provides the client and types for making API requests to Config Service. |
service/configservice/configserviceiface | Package configserviceiface provides an interface to enable mocking the AWS Config service client for testing your code. |
service/connect | Package connect provides the client and types for making API requests to Amazon Connect. |
service/connect/connectiface | Package connectiface provides an interface to enable mocking the Amazon Connect Service service client for testing your code. |
service/costandusagereportservice | Package costandusagereportservice provides the client and types for making API requests to AWS Cost and Usage Report Service. |
service/costandusagereportservice/costandusagereportserviceiface | Package costandusagereportserviceiface provides an interface to enable mocking the AWS Cost and Usage Report Service service client for testing your code. |
service/costexplorer | Package costexplorer provides the client and types for making API requests to AWS Cost Explorer. |
service/costexplorer/costexploreriface | Package costexploreriface provides an interface to enable mocking the AWS Cost Explorer Service service client for testing your code. |
service/databasemigrationservice | Package databasemigrationservice provides the client and types for making API requests to AWS Database Migration Service. |
service/databasemigrationservice/databasemigrationserviceiface | Package databasemigrationserviceiface provides an interface to enable mocking the AWS Database Migration Service service client for testing your code. |
service/datapipeline | Package datapipeline provides the client and types for making API requests to AWS Data Pipeline. |
service/datapipeline/datapipelineiface | Package datapipelineiface provides an interface to enable mocking the AWS Data Pipeline service client for testing your code. |
service/datasync | Package datasync provides the client and types for making API requests to DataSync. |
service/datasync/datasynciface | Package datasynciface provides an interface to enable mocking the AWS DataSync service client for testing your code. |
service/dax | Package dax provides the client and types for making API requests to Amazon DAX. |
service/dax/daxiface | Package daxiface provides an interface to enable mocking the Amazon DynamoDB Accelerator (DAX) service client for testing your code. |
service/devicefarm | Package devicefarm provides the client and types for making API requests to AWS Device Farm. |
service/devicefarm/devicefarmiface | Package devicefarmiface provides an interface to enable mocking the AWS Device Farm service client for testing your code. |
service/directconnect | Package directconnect provides the client and types for making API requests to AWS Direct Connect. |
service/directconnect/directconnectiface | Package directconnectiface provides an interface to enable mocking the AWS Direct Connect service client for testing your code. |
service/directoryservice | Package directoryservice provides the client and types for making API requests to Directory Service. |
service/directoryservice/directoryserviceiface | Package directoryserviceiface provides an interface to enable mocking the AWS Directory Service service client for testing your code. |
service/dlm | Package dlm provides the client and types for making API requests to Amazon DLM. |
service/dlm/dlmiface | Package dlmiface provides an interface to enable mocking the Amazon Data Lifecycle Manager service client for testing your code. |
service/docdb | Package docdb provides the client and types for making API requests to Amazon DocDB. |
service/docdb/docdbiface | Package docdbiface provides an interface to enable mocking the Amazon DocumentDB with MongoDB compatibility service client for testing your code. |
service/dynamodb | Package dynamodb provides the client and types for making API requests to DynamoDB. |
service/dynamodb/dynamodbattribute | Package dynamodbattribute provides marshaling and unmarshaling utilities to convert between Go types and dynamodb.AttributeValues. |
service/dynamodb/dynamodbiface | Package dynamodbiface provides an interface to enable mocking the Amazon DynamoDB service client for testing your code. |
service/dynamodb/expression | Package expression provides types and functions to create Amazon DynamoDB Expression strings, ExpressionAttributeNames maps, and ExpressionAttributeValues maps. |
service/dynamodbstreams | Package dynamodbstreams provides the client and types for making API requests to Amazon DynamoDB Streams. |
service/dynamodbstreams/dynamodbstreamsiface | Package dynamodbstreamsiface provides an interface to enable mocking the Amazon DynamoDB Streams service client for testing your code. |
service/ec2 | Package ec2 provides the client and types for making API requests to Amazon EC2. |
service/ec2/ec2iface | Package ec2iface provides an interface to enable mocking the Amazon Elastic Compute Cloud service client for testing your code. |
service/ec2instanceconnect | Package ec2instanceconnect provides the client and types for making API requests to EC2 Instance Connect. |
service/ec2instanceconnect/ec2instanceconnectiface | Package ec2instanceconnectiface provides an interface to enable mocking the AWS EC2 Instance Connect service client for testing your code. |
service/ecr | Package ecr provides the client and types for making API requests to Amazon ECR. |
service/ecr/ecriface | Package ecriface provides an interface to enable mocking the Amazon EC2 Container Registry service client for testing your code. |
service/ecs | Package ecs provides the client and types for making API requests to Amazon ECS. |
service/ecs/ecsiface | Package ecsiface provides an interface to enable mocking the Amazon EC2 Container Service service client for testing your code. |
service/efs | Package efs provides the client and types for making API requests to EFS. |
service/efs/efsiface | Package efsiface provides an interface to enable mocking the Amazon Elastic File System service client for testing your code. |
service/eks | Package eks provides the client and types for making API requests to Amazon EKS. |
service/eks/eksiface | Package eksiface provides an interface to enable mocking the Amazon Elastic Kubernetes Service service client for testing your code. |
service/elasticache | Package elasticache provides the client and types for making API requests to Amazon ElastiCache. |
service/elasticache/elasticacheiface | Package elasticacheiface provides an interface to enable mocking the Amazon ElastiCache service client for testing your code. |
service/elasticbeanstalk | Package elasticbeanstalk provides the client and types for making API requests to Elastic Beanstalk. |
service/elasticbeanstalk/elasticbeanstalkiface | Package elasticbeanstalkiface provides an interface to enable mocking the AWS Elastic Beanstalk service client for testing your code. |
service/elasticloadbalancing | Package elasticloadbalancing provides the client and types for making API requests to Elastic Load Balancing. |
service/elasticloadbalancing/elasticloadbalancingiface | Package elasticloadbalancingiface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. |
service/elasticloadbalancingv2 | Package elasticloadbalancingv2 provides the client and types for making API requests to Elastic Load Balancing v2. |
service/elasticloadbalancingv2/elasticloadbalancingv2iface | Package elasticloadbalancingv2iface provides an interface to enable mocking the Elastic Load Balancing service client for testing your code. |
service/elasticsearchservice | Package elasticsearchservice provides the client and types for making API requests to Amazon Elasticsearch Service. |
service/elasticsearchservice/elasticsearchserviceiface | Package elasticsearchserviceiface provides an interface to enable mocking the Amazon Elasticsearch Service service client for testing your code. |
service/elastictranscoder | Package elastictranscoder provides the client and types for making API requests to Amazon Elastic Transcoder. |
service/elastictranscoder/elastictranscoderiface | Package elastictranscoderiface provides an interface to enable mocking the Amazon Elastic Transcoder service client for testing your code. |
service/emr | Package emr provides the client and types for making API requests to Amazon EMR. |
service/emr/emriface | Package emriface provides an interface to enable mocking the Amazon Elastic MapReduce service client for testing your code. |
service/eventbridge | Package eventbridge provides the client and types for making API requests to Amazon EventBridge. |
service/eventbridge/eventbridgeiface | Package eventbridgeiface provides an interface to enable mocking the Amazon EventBridge service client for testing your code. |
service/firehose | Package firehose provides the client and types for making API requests to Firehose. |
service/firehose/firehoseiface | Package firehoseiface provides an interface to enable mocking the Amazon Kinesis Firehose service client for testing your code. |
service/fms | Package fms provides the client and types for making API requests to FMS. |
service/fms/fmsiface | Package fmsiface provides an interface to enable mocking the Firewall Management Service service client for testing your code. |
service/forecast | Package forecast provides the client and types for making API requests to Amazon Forecast Service. |
service/forecast/forecastiface | Package forecastiface provides an interface to enable mocking the Amazon Forecast Service service client for testing your code. |
service/forecastquery | Package forecastquery provides the client and types for making API requests to Amazon Forecast Query Service. |
service/forecastquery/forecastqueryiface | Package forecastqueryiface provides an interface to enable mocking the Amazon Forecast Query Service service client for testing your code. |
service/fsx | Package fsx provides the client and types for making API requests to Amazon FSx. |
service/fsx/fsxiface | Package fsxiface provides an interface to enable mocking the Amazon FSx service client for testing your code. |
service/gamelift | Package gamelift provides the client and types for making API requests to Amazon GameLift. |
service/gamelift/gameliftiface | Package gameliftiface provides an interface to enable mocking the Amazon GameLift service client for testing your code. |
service/glacier | Package glacier provides the client and types for making API requests to Amazon Glacier. |
service/glacier/glacieriface | Package glacieriface provides an interface to enable mocking the Amazon Glacier service client for testing your code. |
service/globalaccelerator | Package globalaccelerator provides the client and types for making API requests to AWS Global Accelerator. |
service/globalaccelerator/globalacceleratoriface | Package globalacceleratoriface provides an interface to enable mocking the AWS Global Accelerator service client for testing your code. |
service/glue | Package glue provides the client and types for making API requests to AWS Glue. |
service/glue/glueiface | Package glueiface provides an interface to enable mocking the AWS Glue service client for testing your code. |
service/greengrass | Package greengrass provides the client and types for making API requests to AWS Greengrass. |
service/greengrass/greengrassiface | Package greengrassiface provides an interface to enable mocking the AWS Greengrass service client for testing your code. |
service/groundstation | Package groundstation provides the client and types for making API requests to AWS Ground Station. |
service/groundstation/groundstationiface | Package groundstationiface provides an interface to enable mocking the AWS Ground Station service client for testing your code. |
service/guardduty | Package guardduty provides the client and types for making API requests to Amazon GuardDuty. |
service/guardduty/guarddutyiface | Package guarddutyiface provides an interface to enable mocking the Amazon GuardDuty service client for testing your code. |
service/health | Package health provides the client and types for making API requests to AWSHealth. |
service/health/healthiface | Package healthiface provides an interface to enable mocking the AWS Health APIs and Notifications service client for testing your code. |
service/iam | Package iam provides the client and types for making API requests to IAM. |
service/iam/iamiface | Package iamiface provides an interface to enable mocking the AWS Identity and Access Management service client for testing your code. |
service/inspector | Package inspector provides the client and types for making API requests to Amazon Inspector. |
service/inspector/inspectoriface | Package inspectoriface provides an interface to enable mocking the Amazon Inspector service client for testing your code. |
service/iot | Package iot provides the client and types for making API requests to AWS IoT. |
service/iot1clickdevicesservice | Package iot1clickdevicesservice provides the client and types for making API requests to AWS IoT 1-Click Devices Service. |
service/iot1clickdevicesservice/iot1clickdevicesserviceiface | Package iot1clickdevicesserviceiface provides an interface to enable mocking the AWS IoT 1-Click Devices Service service client for testing your code. |
service/iot1clickprojects | Package iot1clickprojects provides the client and types for making API requests to AWS IoT 1-Click Projects. |
service/iot1clickprojects/iot1clickprojectsiface | Package iot1clickprojectsiface provides an interface to enable mocking the AWS IoT 1-Click Projects Service service client for testing your code. |
service/iotanalytics | Package iotanalytics provides the client and types for making API requests to AWS IoT Analytics. |
service/iotanalytics/iotanalyticsiface | Package iotanalyticsiface provides an interface to enable mocking the AWS IoT Analytics service client for testing your code. |
service/iotdataplane | Package iotdataplane provides the client and types for making API requests to AWS IoT Data Plane. |
service/iotdataplane/iotdataplaneiface | Package iotdataplaneiface provides an interface to enable mocking the AWS IoT Data Plane service client for testing your code. |
service/iotevents | Package iotevents provides the client and types for making API requests to AWS IoT Events. |
service/ioteventsdata | Package ioteventsdata provides the client and types for making API requests to AWS IoT Events Data. |
service/ioteventsdata/ioteventsdataiface | Package ioteventsdataiface provides an interface to enable mocking the AWS IoT Events Data service client for testing your code. |
service/iotevents/ioteventsiface | Package ioteventsiface provides an interface to enable mocking the AWS IoT Events service client for testing your code. |
service/iot/iotiface | Package iotiface provides an interface to enable mocking the AWS IoT service client for testing your code. |
service/iotjobsdataplane | Package iotjobsdataplane provides the client and types for making API requests to AWS IoT Jobs Data Plane. |
service/iotjobsdataplane/iotjobsdataplaneiface | Package iotjobsdataplaneiface provides an interface to enable mocking the AWS IoT Jobs Data Plane service client for testing your code. |
service/iotthingsgraph | Package iotthingsgraph provides the client and types for making API requests to AWS IoT Things Graph. |
service/iotthingsgraph/iotthingsgraphiface | Package iotthingsgraphiface provides an interface to enable mocking the AWS IoT Things Graph service client for testing your code. |
service/kafka | Package kafka provides the client and types for making API requests to Kafka. |
service/kafka/kafkaiface | Package kafkaiface provides an interface to enable mocking the Managed Streaming for Kafka service client for testing your code. |
service/kinesis | Package kinesis provides the client and types for making API requests to Kinesis. |
service/kinesisanalytics | Package kinesisanalytics provides the client and types for making API requests to Kinesis Analytics. |
service/kinesisanalytics/kinesisanalyticsiface | Package kinesisanalyticsiface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code. |
service/kinesisanalyticsv2 | Package kinesisanalyticsv2 provides the client and types for making API requests to Kinesis Analytics V2. |
service/kinesisanalyticsv2/kinesisanalyticsv2iface | Package kinesisanalyticsv2iface provides an interface to enable mocking the Amazon Kinesis Analytics service client for testing your code. |
service/kinesis/kinesisiface | Package kinesisiface provides an interface to enable mocking the Amazon Kinesis service client for testing your code. |
service/kinesisvideo | Package kinesisvideo provides the client and types for making API requests to Kinesis Video. |
service/kinesisvideoarchivedmedia | Package kinesisvideoarchivedmedia provides the client and types for making API requests to Kinesis Video Archived Media. |
service/kinesisvideoarchivedmedia/kinesisvideoarchivedmediaiface | Package kinesisvideoarchivedmediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Archived Media service client for testing your code. |
service/kinesisvideo/kinesisvideoiface | Package kinesisvideoiface provides an interface to enable mocking the Amazon Kinesis Video Streams service client for testing your code. |
service/kinesisvideomedia | Package kinesisvideomedia provides the client and types for making API requests to Kinesis Video Media. |
service/kinesisvideomedia/kinesisvideomediaiface | Package kinesisvideomediaiface provides an interface to enable mocking the Amazon Kinesis Video Streams Media service client for testing your code. |
service/kms | Package kms provides the client and types for making API requests to KMS. |
service/kms/kmsiface | Package kmsiface provides an interface to enable mocking the AWS Key Management Service service client for testing your code. |
service/lakeformation | Package lakeformation provides the client and types for making API requests to AWS Lake Formation. |
service/lakeformation/lakeformationiface | Package lakeformationiface provides an interface to enable mocking the AWS Lake Formation service client for testing your code. |
service/lambda | Package lambda provides the client and types for making API requests to AWS Lambda. |
service/lambda/lambdaiface | Package lambdaiface provides an interface to enable mocking the AWS Lambda service client for testing your code. |
service/lexmodelbuildingservice | Package lexmodelbuildingservice provides the client and types for making API requests to Amazon Lex Model Building Service. |
service/lexmodelbuildingservice/lexmodelbuildingserviceiface | Package lexmodelbuildingserviceiface provides an interface to enable mocking the Amazon Lex Model Building Service service client for testing your code. |
service/lexruntimeservice | Package lexruntimeservice provides the client and types for making API requests to Amazon Lex Runtime Service. |
service/lexruntimeservice/lexruntimeserviceiface | Package lexruntimeserviceiface provides an interface to enable mocking the Amazon Lex Runtime Service service client for testing your code. |
service/licensemanager | Package licensemanager provides the client and types for making API requests to AWS License Manager. |
service/licensemanager/licensemanageriface | Package licensemanageriface provides an interface to enable mocking the AWS License Manager service client for testing your code. |
service/lightsail | Package lightsail provides the client and types for making API requests to Amazon Lightsail. |
service/lightsail/lightsailiface | Package lightsailiface provides an interface to enable mocking the Amazon Lightsail service client for testing your code. |
service/machinelearning | Package machinelearning provides the client and types for making API requests to Amazon Machine Learning. |
service/machinelearning/machinelearningiface | Package machinelearningiface provides an interface to enable mocking the Amazon Machine Learning service client for testing your code. |
service/macie | Package macie provides the client and types for making API requests to Amazon Macie. |
service/macie/macieiface | Package macieiface provides an interface to enable mocking the Amazon Macie service client for testing your code. |
service/managedblockchain | Package managedblockchain provides the client and types for making API requests to ManagedBlockchain. |
service/managedblockchain/managedblockchainiface | Package managedblockchainiface provides an interface to enable mocking the Amazon Managed Blockchain service client for testing your code. |
service/marketplacecommerceanalytics | Package marketplacecommerceanalytics provides the client and types for making API requests to AWS Marketplace Commerce Analytics. |
service/marketplacecommerceanalytics/marketplacecommerceanalyticsiface | Package marketplacecommerceanalyticsiface provides an interface to enable mocking the AWS Marketplace Commerce Analytics service client for testing your code. |
service/marketplaceentitlementservice | Package marketplaceentitlementservice provides the client and types for making API requests to AWS Marketplace Entitlement Service. |
service/marketplaceentitlementservice/marketplaceentitlementserviceiface | Package marketplaceentitlementserviceiface provides an interface to enable mocking the AWS Marketplace Entitlement Service service client for testing your code. |
service/marketplacemetering | Package marketplacemetering provides the client and types for making API requests to AWSMarketplace Metering. |
service/marketplacemetering/marketplacemeteringiface | Package marketplacemeteringiface provides an interface to enable mocking the AWSMarketplace Metering service client for testing your code. |
service/mediaconnect | Package mediaconnect provides the client and types for making API requests to AWS MediaConnect. |
service/mediaconnect/mediaconnectiface | Package mediaconnectiface provides an interface to enable mocking the AWS MediaConnect service client for testing your code. |
service/mediaconvert | Package mediaconvert provides the client and types for making API requests to MediaConvert. |
service/mediaconvert/mediaconvertiface | Package mediaconvertiface provides an interface to enable mocking the AWS Elemental MediaConvert service client for testing your code. |
service/medialive | Package medialive provides the client and types for making API requests to MediaLive. |
service/medialive/medialiveiface | Package medialiveiface provides an interface to enable mocking the AWS Elemental MediaLive service client for testing your code. |
service/mediapackage | Package mediapackage provides the client and types for making API requests to MediaPackage. |
service/mediapackage/mediapackageiface | Package mediapackageiface provides an interface to enable mocking the AWS Elemental MediaPackage service client for testing your code. |
service/mediapackagevod | Package mediapackagevod provides the client and types for making API requests to MediaPackage Vod. |
service/mediapackagevod/mediapackagevodiface | Package mediapackagevodiface provides an interface to enable mocking the AWS Elemental MediaPackage VOD service client for testing your code. |
service/mediastore | Package mediastore provides the client and types for making API requests to MediaStore. |
service/mediastoredata | Package mediastoredata provides the client and types for making API requests to MediaStore Data. |
service/mediastoredata/mediastoredataiface | Package mediastoredataiface provides an interface to enable mocking the AWS Elemental MediaStore Data Plane service client for testing your code. |
service/mediastore/mediastoreiface | Package mediastoreiface provides an interface to enable mocking the AWS Elemental MediaStore service client for testing your code. |
service/mediatailor | Package mediatailor provides the client and types for making API requests to MediaTailor. |
service/mediatailor/mediatailoriface | Package mediatailoriface provides an interface to enable mocking the AWS MediaTailor service client for testing your code. |
service/migrationhub | Package migrationhub provides the client and types for making API requests to AWS Migration Hub. |
service/migrationhub/migrationhubiface | Package migrationhubiface provides an interface to enable mocking the AWS Migration Hub service client for testing your code. |
service/mobile | Package mobile provides the client and types for making API requests to AWS Mobile. |
service/mobileanalytics | Package mobileanalytics provides the client and types for making API requests to Amazon Mobile Analytics. |
service/mobileanalytics/mobileanalyticsiface | Package mobileanalyticsiface provides an interface to enable mocking the Amazon Mobile Analytics service client for testing your code. |
service/mobile/mobileiface | Package mobileiface provides an interface to enable mocking the AWS Mobile service client for testing your code. |
service/mq | Package mq provides the client and types for making API requests to AmazonMQ. |
service/mq/mqiface | Package mqiface provides an interface to enable mocking the AmazonMQ service client for testing your code. |
service/mturk | Package mturk provides the client and types for making API requests to Amazon MTurk. |
service/mturk/mturkiface | Package mturkiface provides an interface to enable mocking the Amazon Mechanical Turk service client for testing your code. |
service/neptune | Package neptune provides the client and types for making API requests to Amazon Neptune. |
service/neptune/neptuneiface | Package neptuneiface provides an interface to enable mocking the Amazon Neptune service client for testing your code. |
service/opsworks | Package opsworks provides the client and types for making API requests to AWS OpsWorks. |
service/opsworkscm | Package opsworkscm provides the client and types for making API requests to OpsWorksCM. |
service/opsworkscm/opsworkscmiface | Package opsworkscmiface provides an interface to enable mocking the AWS OpsWorks CM service client for testing your code. |
service/opsworks/opsworksiface | Package opsworksiface provides an interface to enable mocking the AWS OpsWorks service client for testing your code. |
service/organizations | Package organizations provides the client and types for making API requests to Organizations. |
service/organizations/organizationsiface | Package organizationsiface provides an interface to enable mocking the AWS Organizations service client for testing your code. |
service/personalize | Package personalize provides the client and types for making API requests to Amazon Personalize. |
service/personalizeevents | Package personalizeevents provides the client and types for making API requests to Amazon Personalize Events. |
service/personalizeevents/personalizeeventsiface | Package personalizeeventsiface provides an interface to enable mocking the Amazon Personalize Events service client for testing your code. |
service/personalize/personalizeiface | Package personalizeiface provides an interface to enable mocking the Amazon Personalize service client for testing your code. |
service/personalizeruntime | Package personalizeruntime provides the client and types for making API requests to Amazon Personalize Runtime. |
service/personalizeruntime/personalizeruntimeiface | Package personalizeruntimeiface provides an interface to enable mocking the Amazon Personalize Runtime service client for testing your code. |
service/pi | Package pi provides the client and types for making API requests to AWS PI. |
service/pinpoint | Package pinpoint provides the client and types for making API requests to Amazon Pinpoint. |
service/pinpointemail | Package pinpointemail provides the client and types for making API requests to Pinpoint Email. |
service/pinpointemail/pinpointemailiface | Package pinpointemailiface provides an interface to enable mocking the Amazon Pinpoint Email Service service client for testing your code. |
service/pinpoint/pinpointiface | Package pinpointiface provides an interface to enable mocking the Amazon Pinpoint service client for testing your code. |
service/pinpointsmsvoice | Package pinpointsmsvoice provides the client and types for making API requests to Pinpoint SMS Voice. |
service/pinpointsmsvoice/pinpointsmsvoiceiface | Package pinpointsmsvoiceiface provides an interface to enable mocking the Amazon Pinpoint SMS and Voice Service service client for testing your code. |
service/pi/piiface | Package piiface provides an interface to enable mocking the AWS Performance Insights service client for testing your code. |
service/polly | Package polly provides the client and types for making API requests to Amazon Polly. |
service/polly/pollyiface | Package pollyiface provides an interface to enable mocking the Amazon Polly service client for testing your code. |
service/pricing | Package pricing provides the client and types for making API requests to AWS Pricing. |
service/pricing/pricingiface | Package pricingiface provides an interface to enable mocking the AWS Price List Service service client for testing your code. |
service/qldb | Package qldb provides the client and types for making API requests to QLDB. |
service/qldb/qldbiface | Package qldbiface provides an interface to enable mocking the Amazon QLDB service client for testing your code. |
service/qldbsession | Package qldbsession provides the client and types for making API requests to QLDB Session. |
service/qldbsession/qldbsessioniface | Package qldbsessioniface provides an interface to enable mocking the Amazon QLDB Session service client for testing your code. |
service/quicksight | Package quicksight provides the client and types for making API requests to Amazon QuickSight. |
service/quicksight/quicksightiface | Package quicksightiface provides an interface to enable mocking the Amazon QuickSight service client for testing your code. |
service/ram | Package ram provides the client and types for making API requests to RAM. |
service/ram/ramiface | Package ramiface provides an interface to enable mocking the AWS Resource Access Manager service client for testing your code. |
service/rds | Package rds provides the client and types for making API requests to Amazon RDS. |
service/rdsdata | Package rdsdata provides the client and types for making API requests to AWS RDS DataService. |
service/rdsdata/rdsdataiface | Package rdsdataiface provides an interface to enable mocking the AWS RDS DataService service client for testing your code. |
service/rds/rdsiface | Package rdsiface provides an interface to enable mocking the Amazon Relational Database Service service client for testing your code. |
service/rds/rdsutils | Package rdsutils is used to generate authentication tokens used to connect to a givent Amazon Relational Database Service (RDS) database. |
service/redshift | Package redshift provides the client and types for making API requests to Amazon Redshift. |
service/redshift/redshiftiface | Package redshiftiface provides an interface to enable mocking the Amazon Redshift service client for testing your code. |
service/rekognition | Package rekognition provides the client and types for making API requests to Amazon Rekognition. |
service/rekognition/rekognitioniface | Package rekognitioniface provides an interface to enable mocking the Amazon Rekognition service client for testing your code. |
service/resourcegroups | Package resourcegroups provides the client and types for making API requests to Resource Groups. |
service/resourcegroups/resourcegroupsiface | Package resourcegroupsiface provides an interface to enable mocking the AWS Resource Groups service client for testing your code. |
service/resourcegroupstaggingapi | Package resourcegroupstaggingapi provides the client and types for making API requests to AWS Resource Groups Tagging API. |
service/resourcegroupstaggingapi/resourcegroupstaggingapiiface | Package resourcegroupstaggingapiiface provides an interface to enable mocking the AWS Resource Groups Tagging API service client for testing your code. |
service/robomaker | Package robomaker provides the client and types for making API requests to RoboMaker. |
service/robomaker/robomakeriface | Package robomakeriface provides an interface to enable mocking the AWS RoboMaker service client for testing your code. |
service/route53 | Package route53 provides the client and types for making API requests to Route 53. |
service/route53domains | Package route53domains provides the client and types for making API requests to Amazon Route 53 Domains. |
service/route53domains/route53domainsiface | Package route53domainsiface provides an interface to enable mocking the Amazon Route 53 Domains service client for testing your code. |
service/route53resolver | Package route53resolver provides the client and types for making API requests to Route53Resolver. |
service/route53resolver/route53resolveriface | Package route53resolveriface provides an interface to enable mocking the Amazon Route 53 Resolver service client for testing your code. |
service/route53/route53iface | Package route53iface provides an interface to enable mocking the Amazon Route 53 service client for testing your code. |
service/s3 | Package s3 provides the client and types for making API requests to Amazon S3. |
service/s3control | Package s3control provides the client and types for making API requests to AWS S3 Control. |
service/s3control/s3controliface | Package s3controliface provides an interface to enable mocking the AWS S3 Control service client for testing your code. |
service/s3/s3crypto | Package s3crypto is deprecated and may be removed from the future versions of the SDK. |
service/s3/s3iface | Package s3iface provides an interface to enable mocking the Amazon Simple Storage Service service client for testing your code. |
service/s3/s3manager | Package s3manager provides utilities to upload and download objects from S3 concurrently. |
service/s3/s3manager/s3manageriface | Package s3manageriface provides an interface for the s3manager package |
service/sagemaker | Package sagemaker provides the client and types for making API requests to SageMaker. |
service/sagemakerruntime | Package sagemakerruntime provides the client and types for making API requests to Amazon SageMaker Runtime. |
service/sagemakerruntime/sagemakerruntimeiface | Package sagemakerruntimeiface provides an interface to enable mocking the Amazon SageMaker Runtime service client for testing your code. |
service/sagemaker/sagemakeriface | Package sagemakeriface provides an interface to enable mocking the Amazon SageMaker Service service client for testing your code. |
service/secretsmanager | Package secretsmanager provides the client and types for making API requests to AWS Secrets Manager. |
service/secretsmanager/secretsmanageriface | Package secretsmanageriface provides an interface to enable mocking the AWS Secrets Manager service client for testing your code. |
service/securityhub | Package securityhub provides the client and types for making API requests to AWS SecurityHub. |
service/securityhub/securityhubiface | Package securityhubiface provides an interface to enable mocking the AWS SecurityHub service client for testing your code. |
service/serverlessapplicationrepository | Package serverlessapplicationrepository provides the client and types for making API requests to AWSServerlessApplicationRepository. |
service/serverlessapplicationrepository/serverlessapplicationrepositoryiface | Package serverlessapplicationrepositoryiface provides an interface to enable mocking the AWSServerlessApplicationRepository service client for testing your code. |
service/servicecatalog | Package servicecatalog provides the client and types for making API requests to AWS Service Catalog. |
service/servicecatalog/servicecatalogiface | Package servicecatalogiface provides an interface to enable mocking the AWS Service Catalog service client for testing your code. |
service/servicediscovery | Package servicediscovery provides the client and types for making API requests to ServiceDiscovery. |
service/servicediscovery/servicediscoveryiface | Package servicediscoveryiface provides an interface to enable mocking the AWS Cloud Map service client for testing your code. |
service/servicequotas | Package servicequotas provides the client and types for making API requests to Service Quotas. |
service/servicequotas/servicequotasiface | Package servicequotasiface provides an interface to enable mocking the Service Quotas service client for testing your code. |
service/ses | Package ses provides the client and types for making API requests to Amazon SES. |
service/ses/sesiface | Package sesiface provides an interface to enable mocking the Amazon Simple Email Service service client for testing your code. |
service/sfn | Package sfn provides the client and types for making API requests to AWS SFN. |
service/sfn/sfniface | Package sfniface provides an interface to enable mocking the AWS Step Functions service client for testing your code. |
service/shield | Package shield provides the client and types for making API requests to AWS Shield. |
service/shield/shieldiface | Package shieldiface provides an interface to enable mocking the AWS Shield service client for testing your code. |
service/signer | Package signer provides the client and types for making API requests to signer. |
service/signer/signeriface | Package signeriface provides an interface to enable mocking the AWS Signer service client for testing your code. |
service/simpledb | Package simpledb provides the client and types for making API requests to Amazon SimpleDB. |
service/simpledb/simpledbiface | Package simpledbiface provides an interface to enable mocking the Amazon SimpleDB service client for testing your code. |
service/sms | Package sms provides the client and types for making API requests to SMS. |
service/sms/smsiface | Package smsiface provides an interface to enable mocking the AWS Server Migration Service service client for testing your code. |
service/snowball | Package snowball provides the client and types for making API requests to Amazon Snowball. |
service/snowball/snowballiface | Package snowballiface provides an interface to enable mocking the Amazon Import/Export Snowball service client for testing your code. |
service/sns | Package sns provides the client and types for making API requests to Amazon SNS. |
service/sns/snsiface | Package snsiface provides an interface to enable mocking the Amazon Simple Notification Service service client for testing your code. |
service/sqs | Package sqs provides the client and types for making API requests to Amazon SQS. |
service/sqs/sqsiface | Package sqsiface provides an interface to enable mocking the Amazon Simple Queue Service service client for testing your code. |
service/ssm | Package ssm provides the client and types for making API requests to Amazon SSM. |
service/ssm/ssmiface | Package ssmiface provides an interface to enable mocking the Amazon Simple Systems Manager (SSM) service client for testing your code. |
service/storagegateway | Package storagegateway provides the client and types for making API requests to AWS Storage Gateway. |
service/storagegateway/storagegatewayiface | Package storagegatewayiface provides an interface to enable mocking the AWS Storage Gateway service client for testing your code. |
service/sts | Package sts provides the client and types for making API requests to AWS STS. |
service/sts/stsiface | Package stsiface provides an interface to enable mocking the AWS Security Token Service service client for testing your code. |
service/support | Package support provides the client and types for making API requests to AWS Support. |
service/support/supportiface | Package supportiface provides an interface to enable mocking the AWS Support service client for testing your code. |
service/swf | Package swf provides the client and types for making API requests to Amazon SWF. |
service/swf/swfiface | Package swfiface provides an interface to enable mocking the Amazon Simple Workflow Service service client for testing your code. |
service/textract | Package textract provides the client and types for making API requests to Amazon Textract. |
service/textract/textractiface | Package textractiface provides an interface to enable mocking the Amazon Textract service client for testing your code. |
service/transcribe | Package transcribe provides the client and types for making API requests to Amazon Transcribe Service. |
service/transcribe/transcribeiface | Package transcribeiface provides an interface to enable mocking the Amazon Transcribe Service service client for testing your code. |
service/transfer | Package transfer provides the client and types for making API requests to AWS Transfer. |
service/transfer/transferiface | Package transferiface provides an interface to enable mocking the AWS Transfer for SFTP service client for testing your code. |
service/translate | Package translate provides the client and types for making API requests to Amazon Translate. |
service/translate/translateiface | Package translateiface provides an interface to enable mocking the Amazon Translate service client for testing your code. |
service/waf | Package waf provides the client and types for making API requests to WAF. |
service/wafregional | Package wafregional provides the client and types for making API requests to WAF Regional. |
service/wafregional/wafregionaliface | Package wafregionaliface provides an interface to enable mocking the AWS WAF Regional service client for testing your code. |
service/waf/wafiface | Package wafiface provides an interface to enable mocking the AWS WAF service client for testing your code. |
service/workdocs | Package workdocs provides the client and types for making API requests to Amazon WorkDocs. |
service/workdocs/workdocsiface | Package workdocsiface provides an interface to enable mocking the Amazon WorkDocs service client for testing your code. |
service/worklink | Package worklink provides the client and types for making API requests to WorkLink. |
service/worklink/worklinkiface | Package worklinkiface provides an interface to enable mocking the Amazon WorkLink service client for testing your code. |
service/workmail | Package workmail provides the client and types for making API requests to Amazon WorkMail. |
service/workmailmessageflow | Package workmailmessageflow provides the client and types for making API requests to Amazon WorkMail Message Flow. |
service/workmailmessageflow/workmailmessageflowiface | Package workmailmessageflowiface provides an interface to enable mocking the Amazon WorkMail Message Flow service client for testing your code. |
service/workmail/workmailiface | Package workmailiface provides an interface to enable mocking the Amazon WorkMail service client for testing your code. |
service/workspaces | Package workspaces provides the client and types for making API requests to Amazon WorkSpaces. |
service/workspaces/workspacesiface | Package workspacesiface provides an interface to enable mocking the Amazon WorkSpaces service client for testing your code. |
service/xray | Package xray provides the client and types for making API requests to AWS X-Ray. |
service/xray/xrayiface | Package xrayiface provides an interface to enable mocking the AWS X-Ray service client for testing your code. |
- Version
- v0.13.0
- Published
- Oct 2, 2019
- Platform
- darwin/amd64
- Last checked
- 1 minute ago –
Tools for package owners.